254781156

254781156

hypothetical protein CLIBASIA_05315

GeneID in NCBI database:8210181Locus tag:CLIBASIA_05315
Protein GI in NCBI database:254781156Protein Accession:YP_003065569.1
Gene range:+(1150921, 1151385)Protein Length:154aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MRKNLLTSTSSLMFFFLSSGYALSGSSFGCCGEFKKKASSPRIHMRPFTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYSSSSASSSTHASPPPHFEQKHISRTRIDSSPPPGHIDPHPDHIRNTLALHRKMLEQS
cccHHHHHHHHHHHHHHHccccccccccccHHHHHHccccccEEEEcccccccccccHHHHcccccccccHHHHHccccccccccEEcccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcc
cccHHcccHHHHHHHHHHccccccccccccccHHccccccccEEEccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccEccEccccccccccccccHHHHHHHHHHHHHHHcc
MRKNLLTSTSSLMFFFLSsgyalsgssfgccgefkkkassprihmrpftksspynnsvsntvnntprvpdvsemnssrgsapqshvnvssphykheyssssasssthasppphfeqkhisrtridsspppghidphpdhIRNTLALHRKMLEQS
MRKNLLTSTSSLMFFFLSSGYALSGSSFGCCGEFKKKassprihmrpftksspynnsvsntvnntprvPDVSEMNSSRGSAPQSHVNVSSPHYKHEYSSSSASSSTHASPPPHFEQKHISRTRIDSSPPPGHIDPHPDHIRNTLALHRKMLEQS
MRKNlltstsslmffflssGYALSGSSFGCCGEFKKKASSPRIHMRPFTKSSPYnnsvsntvnntPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYssssasssthasppphFEQKHISRTRidsspppghidphpdhiRNTLALHRKMLEQS
********TSSLMFFFLSSGYALSGSSFGCCGEFKK************T**********NTVNNTPR*****************************************************************IDPHPDHIRNTLALHRKML***
MRKNLLTSTSSLMFFFLSSGYALSGSSFGCCGEFKKKASSPRIHMRPFTKSSPYNNSVSNTVNNTPRVPD*************************************************SRTRIDSSPPPGHIDPHPDHIRNTLALHRKMLEQS
******TSTSSLMFFFLSSGYALSGSSFGCCGEFKKKASSPRIHMRPFTKSSPYNN******************************************************************RIDSSPPPGHIDPHPDHIRNTLALHRKML***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MRKNLLTSTSSLMFFFLSSGYALSGSSFGCCGEFKKKASSPRIHMRPFTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYSSSSASSSTHASPPPHFEQKHISRTRIDSSPPPGHIDPHPDHIRNTLALHRKMLEQS
MRKNLLTSTSSLMFFFLSSGYALSGSSFGCCGEFKKKASSPRIHMRPFTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYSSSSASSSTHASPPPHFEQKHISRTRIDSSPPPGHIDPHPDHIRNTLALHRKMLEQS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target154 hypothetical protein CLIBASIA_05315 [Candidatus Liberib
218548412 1281 DNA-binding membrane protein [Escherichia fergusonii AT 2 0.003
>gi|218548412|ref|YP_002382203.1| DNA-binding membrane protein [Escherichia fergusonii ATCC 35469] Length = 1281 Back     alignment and organism information
 Score = 45.6 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 42/107 (39%), Gaps = 7/107 (6%)

Query: 39  SSPRIHMRPFTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYS 98
           + P I  +P          ++ T +  P+ P  ++        PQ    V  P+Y     
Sbjct: 354 AQPDIDWQPVPGPQTGEPVIATTPDGYPQQPQYAQPAVHYNEPPQPTAPVQQPYYASAPE 413

Query: 99  SSSASSSTHASP-----PPH--FEQKHISRTRIDSSPPPGHIDPHPD 138
            S A +S  A P      PH  ++ +  S+   +  P  GH+ PHPD
Sbjct: 414 QSVAENSWQAEPQQSAYAPHSTYQAEQTSQVEQNYQPDVGHVAPHPD 460


Species: Escherichia fergusonii
Genus: Escherichia
Family: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00