254781155

254781155

hypothetical protein CLIBASIA_05310

GeneID in NCBI database:8210180Locus tag:CLIBASIA_05310
Protein GI in NCBI database:254781155Protein Accession:YP_003065568.1
Gene range:-(1150381, 1150488)Protein Length:35aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30-----
MGFKKPYQNQIEHAQGGRKTTAWLVHIFKKNLMER
cccccHHHHHHHHHHcccHHHHHHHHHHHHHHHcc
ccccccHHHHHHHHccccHHHHHHHHHHHHHHHcc
mgfkkpyqnqiehaqggrkTTAWLVHIFKKNLMER
mgfkkpyqnqiehaqggrkttaWLVHIFKKNLMER
MGFKKPYQNQIEHAQGGRKTTAWLVHIFKKNLMER
**************QGGRKTTAWLVHIFKKNL***
MGFKKPYQNQIEHAQGGRKTTAWLVHIFKKNLMER
*GFKKPYQNQIEHAQGGRKTTAWLVHIFKKNLM**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhhhhoooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFKKPYQNQIEHAQGGRKTTAWLVHIFKKNLMER
MGFKKPYQNQIEHAQGGRKTTAWLVHIFKKNLMER
MGFKKPYQNQIEHAQGGRKTTAWLVHIFKKNLMER

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target35 hypothetical protein CLIBASIA_05310 [Candidatus Liberib
254780989185 GCN5-related N-acetyltransferase [Candidatus Liber 1e-09
>gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Back     alignment
 Score = 52.4 bits (124), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 22/34 (64%), Positives = 27/34 (79%)

Query: 1   MGFKKPYQNQIEHAQGGRKTTAWLVHIFKKNLME 34
           +GFKKP+Q+QI +A GG   T WLVHIFK N+ME
Sbjct: 139 LGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIME 172

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target35 hypothetical protein CLIBASIA_05310 [Candidatus Liberib
254780989185 GCN5-related N-acetyltransferase [Candidatus Liberibact 1 2e-05
>gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Back     alignment and organism information
 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/34 (64%), Positives = 27/34 (79%)

Query: 1   MGFKKPYQNQIEHAQGGRKTTAWLVHIFKKNLME 34
           +GFKKP+Q+QI +A GG   T WLVHIFK N+ME
Sbjct: 139 LGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIME 172


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00