254781161

254781161

glutamate--cysteine ligase

GeneID in NCBI database:8210186Locus tag:CLIBASIA_05340
Protein GI in NCBI database:254781161Protein Accession:YP_003065574.1
Gene range:+(1157084, 1158457)Protein Length:457aa
Gene description:glutamate--cysteine ligase
COG prediction:[H] Gamma-glutamylcysteine synthetase
KEGG prediction:gshA; glutamate--cysteine ligase; K01919 glutamate--cysteine ligase [EC:6.3.2.2]
SEED prediction:Glutamate--cysteine ligase (EC 6.3.2.2)
Pathway involved in KEGG:Glutathione metabolism [PATH:las00480]
Subsystem involved in SEED:Glutathione: Biosynthesis and gamma-glutamyl cycle;
Glutathione: Non-redox reactions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------
MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY
cccccccccccccHHHHHHHHHHcccccccccEEEEEEEccccccccccccccccccHHHHHHHHHHHccccccccccEEccccccccccEEEEccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccHHccccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHccccEEEEccccccccccccHHHHHccccccccccccccHHHHHHcccccccccccccEEEEcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHcc
cccccccccccccHHHHHHHHHccccccHcccEccEcccccccccccccccccccHHHHHHHHHHHHHcccccccccccEEEEEccccccEEEEccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccccHccccccccHHHHHHHHHccccccccHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHccccEEEEEEcccEEEcccccHHHHHccccccccccccccHHHHHHHHHcccccccHHHHHHHcccccccHHHHcccHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHccHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHcc
mtcnplantiVTSIDDLVQHIAsgikpqeefrigtehesfifsradhrplpydgeKSIVTILQAIQKKLAWKEIMDKgniiglanplskagisiepggqlelstTTLQNVHQIKGEILGYIQILKEITQNLdlgilgmgfnpkwkldempimpkSRYVLMKKympqvgthgldmmfrtcttqvsldfssehdmATKLRVSfklqplataifasspfaegriNGFQSWRSeiwrhtdsdrteilpfilrdnsnfeHYAQWALDIPMYFILrkkeyycctdITFRQFMNGALKGrikewhptlEDWENHLSTLFPAVRLRNClemrgadsgrLENIFAVAAFWTGILydssalqnadhltsswsfydinklnntvpskgmrstvrgqslKDIAIQILTFAHQglknrsaknhlqedetiFLKPLEKIIHNNQTTADEMLAAYHTrwgksidpcfeeyay
MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGfnpkwkldempIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIfasspfaeGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY
MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY
*************IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGN**G***PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY
MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY
****PLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY
MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY
MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target457 glutamate--cysteine ligase [Candidatus Liberibacter asi
315122546457 glutamate--cysteine ligase [Candidatus Liberibacter sol 1 0.0
327191157457 gamma-glutamylcysteine synthetase protein [Rhizobium et 1 1e-143
150395612457 glutamate--cysteine ligase [Sinorhizobium medicae WSM41 1 1e-143
218680826457 gamma-glutamylcysteine synthetase protein [Rhizobium et 1 1e-143
86356449457 glutamate-cysteine ligase protein [Rhizobium etli CFN 4 1 1e-142
307308471481 glutamate/cysteine ligase [Sinorhizobium meliloti BL225 1 1e-142
190890509457 gamma-glutamylcysteine synthetase [Rhizobium etli CIAT 1 1e-142
195970199457 putative glutamate--cysteine ligase precursor protein [ 1 1e-142
222084969457 glutamate--cysteine ligase [Agrobacterium radiobacter K 1 1e-141
227820964457 glutamate-cysteine ligase protein [Sinorhizobium fredii 1 1e-141
>gi|315122546|ref|YP_004063035.1| glutamate--cysteine ligase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 457 Back     alignment and organism information
 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/451 (71%), Positives = 385/451 (85%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           +NTI+TS DDLV+++ASG+K Q++F+IGTEHE F+FSR+DHRP+PY GEK I+ +L  IQ
Sbjct: 7   SNTIITSTDDLVEYMASGVKSQQDFKIGTEHEHFVFSRSDHRPIPYRGEKGILNLLHKIQ 66

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
           K L WK I+DKGN+IGL NP +KAGIS+EPGGQLE+S+ TLQNVHQIK EI  YI++LKE
Sbjct: 67  KTLGWKAIIDKGNLIGLINPANKAGISLEPGGQLEVSSDTLQNVHQIKEEIFYYIKVLKE 126

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
            T++LDLG+LG+GFNPKW LDE+PIMPKSRY +MK+YMPQVGT GL+MMFRTCTTQVSLD
Sbjct: 127 ATKDLDLGVLGIGFNPKWTLDEIPIMPKSRYKIMKEYMPQVGTQGLEMMFRTCTTQVSLD 186

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           F SE DMATKLRVS KLQPLATA+FASSPF EGR NGFQSWRSEIWRHTD++RT ILPF 
Sbjct: 187 FCSEQDMATKLRVSLKLQPLATALFASSPFTEGRPNGFQSWRSEIWRHTDNNRTGILPFA 246

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             +N  FE YAQWALDIPMY++LR  EY+ CTDI FRQFMNGALKGR+++WHPT+ DWEN
Sbjct: 247 FENNYGFEDYAQWALDIPMYYVLRDNEYHACTDINFRQFMNGALKGRVEQWHPTIGDWEN 306

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HLSTLFP VRLRNCLEMRGAD+   E I A+ AFWTG+LYDSSALQNAD LTS+WSF+D+
Sbjct: 307 HLSTLFPDVRLRNCLEMRGADASTSEKILAITAFWTGLLYDSSALQNADDLTSTWSFHDV 366

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
           N L N VPS+G+ + + GQSLK IA Q+L+F+  GLKNR+  N  +EDETIFLKPLEKII
Sbjct: 367 NDLRNIVPSEGLNAKIDGQSLKSIAAQVLSFSQNGLKNRAKVNFQREDETIFLKPLEKII 426

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           H++Q+ +DE+L AYH RW  S++P FEEYAY
Sbjct: 427 HSDQSFSDEILTAYHGRWNNSVEPYFEEYAY 457


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327191157|gb|EGE58201.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli CNPAF512] Length = 457 Back     alignment and organism information
>gi|150395612|ref|YP_001326079.1| glutamate--cysteine ligase [Sinorhizobium medicae WSM419] Length = 457 Back     alignment and organism information
>gi|218680826|ref|ZP_03528723.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli CIAT 894] Length = 457 Back     alignment and organism information
>gi|86356449|ref|YP_468341.1| glutamate-cysteine ligase protein [Rhizobium etli CFN 42] Length = 457 Back     alignment and organism information
>gi|307308471|ref|ZP_07588175.1| glutamate/cysteine ligase [Sinorhizobium meliloti BL225C] Length = 481 Back     alignment and organism information
>gi|190890509|ref|YP_001977051.1| gamma-glutamylcysteine synthetase [Rhizobium etli CIAT 652] Length = 457 Back     alignment and organism information
>gi|195970199|ref|NP_384876.2| putative glutamate--cysteine ligase precursor protein [Sinorhizobium meliloti 1021] Length = 457 Back     alignment and organism information
>gi|222084969|ref|YP_002543498.1| glutamate--cysteine ligase [Agrobacterium radiobacter K84] Length = 457 Back     alignment and organism information
>gi|227820964|ref|YP_002824934.1| glutamate-cysteine ligase protein [Sinorhizobium fredii NGR234] Length = 457 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target457 glutamate--cysteine ligase [Candidatus Liberibacter asi
PLN02611482 PLN02611, PLN02611, glutamate--cysteine ligase 1e-147
TIGR01436446 TIGR01436, glu_cys_lig_pln, glutamate--cysteine ligase, 1e-144
COG3572456 COG3572, GshA, Gamma-glutamylcysteine synthetase [Coenz 1e-152
pfam04107291 pfam04107, GCS2, Glutamate-cysteine ligase family 2(GCS 1e-58
TIGR03444390 TIGR03444, gshA_related, glutamate--cysteine ligase fam 1e-28
COG2170369 COG2170, COG2170, Uncharacterized conserved protein [Fu 2e-05
PRK13517373 PRK13517, PRK13517, carboxylate-amine ligase; Provision 2e-05
PRK13515371 PRK13515, PRK13515, carboxylate-amine ligase; Provision 3e-05
TIGR02050287 TIGR02050, gshA_cyan_rel, uncharacterized enzyme 3e-05
>gnl|CDD|178221 PLN02611, PLN02611, glutamate--cysteine ligase Back     alignment and domain information
>gnl|CDD|130503 TIGR01436, glu_cys_lig_pln, glutamate--cysteine ligase, plant type Back     alignment and domain information
>gnl|CDD|33374 COG3572, GshA, Gamma-glutamylcysteine synthetase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|146638 pfam04107, GCS2, Glutamate-cysteine ligase family 2(GCS2) Back     alignment and domain information
>gnl|CDD|163269 TIGR03444, gshA_related, glutamate--cysteine ligase family protein Back     alignment and domain information
>gnl|CDD|32353 COG2170, COG2170, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|184107 PRK13517, PRK13517, carboxylate-amine ligase; Provisional Back     alignment and domain information
>gnl|CDD|184105 PRK13515, PRK13515, carboxylate-amine ligase; Provisional Back     alignment and domain information
>gnl|CDD|162674 TIGR02050, gshA_cyan_rel, uncharacterized enzyme Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 457 glutamate--cysteine ligase [Candidatus Liberibacter asi
TIGR01436446 glu_cys_lig_pln glutamate--cysteine ligase; InterPro: I 100.0
COG3572456 GshA Gamma-glutamylcysteine synthetase [Coenzyme metabo 100.0
TIGR03444390 gshA_related glutamate--cysteine ligase family protein. 100.0
PRK13517371 carboxylate-amine ligase; Provisional 100.0
PRK13515381 carboxylate-amine ligase; Provisional 100.0
PRK13516372 carboxylate-amine ligase; Provisional 100.0
PRK13518357 carboxylate-amine ligase; Provisional 100.0
COG2170369 Uncharacterized conserved protein [Function unknown] 100.0
PRK02107523 glutamate--cysteine ligase; Provisional 99.46
PRK02471 753 bifunctional glutamate--cysteine ligase/glutathione syn 99.29
COG2918518 GshA Gamma-glutamylcysteine synthetase [Coenzyme metabo 99.17
TIGR01434518 glu_cys_ligase glutamate--cysteine ligase; InterPro: IP 97.26
pfam04107291 GCS2 Glutamate-cysteine ligase family 2(GCS2). Also kno 100.0
TIGR02050297 gshA_cyan_rel uncharacterized enzyme; InterPro: IPR0117 100.0
TIGR02048377 gshA_cyano glutamate--cysteine ligase, putative; InterP 99.88
pfam03074365 GCS Glutamate-cysteine ligase. This family represents t 99.16
pfam04262377 Glu_cys_ligase Glutamate-cysteine ligase. Family of bac 98.75
KOG3754 640 consensus 98.54
TIGR03105435 gln_synth_III glutamine synthetase, type III. This fami 98.23
COG0174443 GlnA Glutamine synthetase [Amino acid transport and met 98.15
pfam00120257 Gln-synt_C Glutamine synthetase, catalytic domain. 97.13
pfam12224250 Amidoligase_2 Putative amidoligase enzyme. This family 97.86
PRK09469469 glnA glutamine synthetase; Provisional 97.35
TIGR00653486 GlnA glutamine synthetase, type I; InterPro: IPR004809 90.61
>TIGR01436 glu_cys_lig_pln glutamate--cysteine ligase; InterPro: IPR011556 These sequences represent one of two highly dissimilar forms of glutamate--cysteine ligase (gamma-glutamylcysteine synthetase), an enzyme of glutathione biosynthesis Back     alignment and domain information
>COG3572 GshA Gamma-glutamylcysteine synthetase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03444 gshA_related glutamate--cysteine ligase family protein Back     alignment and domain information
>PRK13517 carboxylate-amine ligase; Provisional Back     alignment and domain information
>PRK13515 carboxylate-amine ligase; Provisional Back     alignment and domain information
>PRK13516 carboxylate-amine ligase; Provisional Back     alignment and domain information
>PRK13518 carboxylate-amine ligase; Provisional Back     alignment and domain information
>COG2170 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02107 glutamate--cysteine ligase; Provisional Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>COG2918 GshA Gamma-glutamylcysteine synthetase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01434 glu_cys_ligase glutamate--cysteine ligase; InterPro: IPR006334 These sequences represent glutamate--cysteine ligase, also known as gamma-glutamylcysteine synthetase, an enzyme in the biosynthesis of glutathione (GSH) Back     alignment and domain information
>pfam04107 GCS2 Glutamate-cysteine ligase family 2(GCS2) Back     alignment and domain information
>TIGR02050 gshA_cyan_rel uncharacterized enzyme; InterPro: IPR011793 This family represents a division of a larger family, the other branch of which is predicted to act as glutamate--cysteine ligase (the first of two enzymes in glutathione biosynthesis) in the cyanobacteria Back     alignment and domain information
>TIGR02048 gshA_cyano glutamate--cysteine ligase, putative; InterPro: IPR011792 This family consists of proteins believed to be the glutamate--cysteine ligases of several cyanobacteria, which are known to make glutathione Back     alignment and domain information
>pfam03074 GCS Glutamate-cysteine ligase Back     alignment and domain information
>pfam04262 Glu_cys_ligase Glutamate-cysteine ligase Back     alignment and domain information
>KOG3754 consensus Back     alignment and domain information
>TIGR03105 gln_synth_III glutamine synthetase, type III Back     alignment and domain information
>COG0174 GlnA Glutamine synthetase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam00120 Gln-synt_C Glutamine synthetase, catalytic domain Back     alignment and domain information
>pfam12224 Amidoligase_2 Putative amidoligase enzyme Back     alignment and domain information
>PRK09469 glnA glutamine synthetase; Provisional Back     alignment and domain information
>TIGR00653 GlnA glutamine synthetase, type I; InterPro: IPR004809 Glutamine synthetase type I (or glutamate-ammonia ligase) has a dodecameric form, which can be subdivided into 1-alpha and 1-beta forms Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target457 glutamate--cysteine ligase [Candidatus Liberibacter asi
2gwd_A449 Crystal Structure Of Plant Glutamate Cysteine Ligas 1e-117
2gwc_A449 Crystal Structure Of Plant Glutamate Cysteine Ligas 1e-110
1tt4_A396 Structure Of Np459575, A Predicted Glutathione Synt 8e-19
1r8g_A372 Structure And Function Of Ybdk Length = 372 8e-19
>gi|110590457|pdb|2GWD|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase In Complex With Mg2+ And L-Glutamate Length = 449 Back     alignment and structure
 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 204/452 (45%), Positives = 281/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K +E++RIGTEHE F F     RP+ YD    I  +L +I
Sbjct: 11  VATEPLT-REDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSI 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 67  AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 124

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LGMGF PKW+ +++P MPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 125 AVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNL 184

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 185 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 244

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L        PT  DWE
Sbjct: 245 VFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLP-GELPTYNDWE 303

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  +EMRGAD G    + A+ AFW G+LYD   LQ+   LT+ W+  +
Sbjct: 304 NHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAE 363

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + ++
Sbjct: 364 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EVGFLNAVTEV 417

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  Y+  WG+S+DP F+E  Y
Sbjct: 418 VRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 449


>gi|110590449|pdb|2GWC|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase In Complex With A Transition State Analogue Length = 449 Back     alignment and structure
>gi|52695850|pdb|1TT4|A Chain A, Structure Of Np459575, A Predicted Glutathione Synthase From Salmonella Typhimurium Length = 396 Back     alignment and structure
>gi|52695375|pdb|1R8G|A Chain A, Structure And Function Of Ybdk Length = 372 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target457 glutamate--cysteine ligase [Candidatus Liberibacter asi
2gwd_A449 Glutamate cysteine ligase; disulfide bridges, glutathio 1e-111
1r8g_A372 Hypothetical protein YBDK; structural genomics, unknown 2e-46
>2gwd_A Glutamate cysteine ligase; disulfide bridges, glutathione biosynthesis, beta-hairpin, redox regulation; HET: GLU; 2.09A {Brassica juncea} PDB: 2gwc_A* Length = 449 Back     alignment and structure
 Score =  397 bits (1022), Expect = e-111
 Identities = 202/443 (45%), Positives = 277/443 (62%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K +E++RIGTEHE F F     RP+ YD    I  +L +I ++  W+++
Sbjct: 19  EDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQ---IAELLNSIAERFEWEKV 75

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 76  MEGDKIIGLKQG--KQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 133

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LGMGF PKW+ +++P MPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE DM 
Sbjct: 134 FLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMI 193

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 194 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 253

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L     E  PT  DWENHL+T+FP 
Sbjct: 254 QYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFPE 312

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+LYD   LQ+   LT+ W+  +   L N VP
Sbjct: 313 VRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVP 372

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R         E  FL  + +++    T A+
Sbjct: 373 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGY------KEVGFLNAVTEVVRTGVTPAE 426

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+  WG+S+DP F+E  Y
Sbjct: 427 NLLEMYNGEWGQSVDPVFQELLY 449


>1r8g_A Hypothetical protein YBDK; structural genomics, unknown function, carboxylate-amine ligase, structure 2 function project, S2F; 2.15A {Escherichia coli} SCOP: d.128.1.3 PDB: 1tt4_A Length = 372 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target457 glutamate--cysteine ligase [Candidatus Liberibacter asi
2gwd_A449 Glutamate cysteine ligase; disulfide bridges, glutathio 100.0
1r8g_A372 Hypothetical protein YBDK; structural genomics, unknown 100.0
1va6_A518 Glutamate--cysteine ligase; glutathione homeostasis, be 99.56
3ig5_A692 Glutamate-cysteine ligase; glutathione, ATP-grAsp, ATP- 99.45
3nzt_A525 Glutamate--cysteine ligase; structural genomics, center 99.42
1f52_A468 Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A 96.82
2bvc_A486 Glutamine synthetase 1; ligase, transition state mimic; 95.2
2d3a_A356 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea 95.96
2j9i_A421 Glutamate-ammonia ligase domain-containing protein 1; 1 94.09
3fky_A370 Glutamine synthetase; beta-grAsp, catalytic domain, ace 91.86
>2gwd_A Glutamate cysteine ligase; disulfide bridges, glutathione biosynthesis, beta-hairpin, redox regulation; HET: GLU; 2.09A {Brassica juncea} PDB: 2gwc_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=740.42  Aligned_cols=440  Identities=46%  Similarity=0.865  Sum_probs=424.7

Q ss_pred             CCCCHHHCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCEECCC
Q ss_conf             43311214899999999837987203558677765387476578487112234999999755524886461278410233
Q gi|254781161|r    5 PLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLA   84 (457)
Q Consensus         5 ~~~~~~~~~~~~l~~~f~~g~k~~~~~~IG~E~E~flvd~~~~~p~~~~~~~~i~~~L~~l~~~~~~~~~~~~~~~~~l~   84 (457)
                      +.+.+++ ++++|++||++|||++++++||+|+|+|+||+++++||||+   ++.++|+.|.+.|+|+++.+++++|+|.
T Consensus        10 ~~~~~~~-~~~~l~~~~~~g~k~~~~~~IG~E~E~~~v~~~~~~~v~~~---~i~~~l~~l~~~~~~~~~~e~~~~i~l~   85 (449)
T 2gwd_A           10 VVATEPL-TREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSIAERFEWEKVMEGDKIIGLK   85 (449)
T ss_dssp             ----CCC-CHHHHHHHHHTTCCCGGGCCEEEEEEEEEEETTTCCBCCHH---HHHHHHHHHHHHHTCEEEEETTEEEEEE
T ss_pred             CCCCCCC-CHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCHH---HHHHHHHHHHHHCCCCEECCCCCCCCCC
T ss_conf             5568987-99999999992787777875898666346547989879838---8999999988761884315788630204


Q ss_pred             CCCCCCCEEECCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCHHHHHCCHHHHHHHHHHHH
Q ss_conf             45688703413542024201101015677888888788878742103873421056878884542000001356666654
Q gi|254781161|r   85 NPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM  164 (457)
Q Consensus        85 ~~~~~~~it~ep~~qlE~s~~~~~~~~e~~~~~~~~~~~l~~il~~~~~~~~~~g~~P~~~~~~~~~~~~~Ry~~m~~~~  164 (457)
                      +  ++.+||+|||||||+|++||.+++++++++..++..+.++++++|+.++++|+||++.+.++.++|++||+.|..++
T Consensus        86 ~--~~~~it~EPg~QiEls~~p~~~i~e~~~~~~~~~~~l~~~~~~~g~~l~~~G~~P~~~~~~~~~~~k~RY~~m~~~~  163 (449)
T 2gwd_A           86 Q--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYM  163 (449)
T ss_dssp             E--TTEEEEECTTCCEEEECCCBSSHHHHHHHHHHHHHHHHHHHHHHTEEEECCSBCSSCCGGGSCCCSCHHHHHHHHHG
T ss_pred             C--CCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             6--89626426996678605666788999999999999999999976986302576898874436678825889998740


Q ss_pred             HHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCC
Q ss_conf             32112678887631340475147898899999999987656788874378655887787432268885202777886565
Q gi|254781161|r  165 PQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP  244 (457)
Q Consensus       165 ~~~g~~~~~mm~~tas~Qv~id~~~~~d~~~~~n~a~~l~P~llAL~aNSPf~~G~~~g~~s~R~~i~~~~d~~r~~~~~  244 (457)
                      +.+|.++++||+.|||+||||||.+++|+++++|++++++|+++|||||||||+|+++|+.|+|..+|+++|+.||+.++
T Consensus       164 ~~~g~~~~~mm~~t~s~qV~vd~~~~ed~~~~~~~a~~l~P~l~AL~ANSPf~~G~~tg~~s~R~~iw~~~d~~R~g~~~  243 (449)
T 2gwd_A          164 PKVGSLGLDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLP  243 (449)
T ss_dssp             GGTCSSHHHHHHHBCEEEEEECCSSHHHHHHHHHHHHHHHHHHHHHHCCBCEETTEECSCSBHHHHHTTSSCGGGCSCCG
T ss_pred             CCCCCHHHHHHHHHEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCC
T ss_conf             04474146677651014660078747779999999988635999998559544798786224567886425767888887


Q ss_pred             CCCCCCCCHHHHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCEEEC
Q ss_conf             44577541999999985145316305875326678887885126432101365546677531123456643335501211
Q gi|254781161|r  245 FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR  324 (457)
Q Consensus       245 ~~~~~~~~~e~y~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~d~~~~~~~~f~~~r~~~~IEiR  324 (457)
                      ..|.++++|++|+++++++++++..+++.++...+.++.+++.+.... .....++.+||++|+++.|+++|+|++||+|
T Consensus       244 ~~~~~~~~~e~y~~~~l~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~-~~~~~~t~~d~~~~ls~~f~~vr~k~~IEiR  322 (449)
T 2gwd_A          244 FVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPC-LPGELPTYNDWENHLTTIFPEVRLKRYMEMR  322 (449)
T ss_dssp             GGGSTTCSHHHHHHHHHHSCEEEEEETTEEEEEEEECHHHHHTTCCTT-STTCCCCHHHHHHHHTTCCCSEEESSSEEEE
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCCEECCCCCCHHHHHCCCCCC-CCCCCCHHHHHHHHHHHCCCCCCCCCCEEEC
T ss_conf             656774116789999987477763246641037995688760465300-1467851889999875046565551220013


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             57888866755558889887653885443232023699999999999997631158668830899999999999998985
Q gi|254781161|r  325 GADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKN  404 (457)
Q Consensus       325 ~~Ds~P~~~~~a~aAf~~gl~~~~~~~~~~~~~~~~~~~~~~~~~~~~aar~Gl~a~~~~~~~~~l~~~ll~~A~~GL~~  404 (457)
                      ++|+||...+++++|||.|++++..++++..+.+..|+++++.+|+++|+|+||++.+.++++.+++++|+++|++||++
T Consensus       323 ~~D~~p~~~~~a~~A~~~gll~~~~~~~~~~~~~~~~~~~~~~~~~~~aar~GL~~~~~~~~l~~~~~~ll~~A~~GL~~  402 (449)
T 2gwd_A          323 GADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLER  402 (449)
T ss_dssp             EEECCCHHHHHHHHHHHHHHHSSHHHHHHHHHHTTTCCHHHHHHHHHHHHHHGGGSEETTEEHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             66778527788999999999734888998665553079999999999999866589868833999999999999999998


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             23124556458899999999998389858999998710221888999887679
Q gi|254781161|r  405 RSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY  457 (457)
Q Consensus       405 r~~~~~~~~dE~~yL~~l~~~i~~g~t~A~~~l~~y~~~~~~~i~~i~~~~~~  457 (457)
                      ||.      +|++||++|++++++|+|||+++|++|+++|++||++||+++||
T Consensus       403 rg~------~E~~yL~~L~~~~~~g~t~A~~~l~~y~~~~~~~i~~v~~~~~~  449 (449)
T 2gwd_A          403 RGY------KEVGFLNAVTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  449 (449)
T ss_dssp             HTS------CCGGGGHHHHHHHHHTCCHHHHHHHHHHTTTTTCSTTHHHHTBC
T ss_pred             CCC------CHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHCC
T ss_conf             599------87899999999998399889999999646013899999987559



>1r8g_A Hypothetical protein YBDK; structural genomics, unknown function, carboxylate-amine ligase, structure 2 function project, S2F; 2.15A {Escherichia coli} SCOP: d.128.1.3 PDB: 1tt4_A Back     alignment and structure
>1va6_A Glutamate--cysteine ligase; glutathione homeostasis, beta barrel, peptide synthesis, transition state analogue; HET: P2S ADP P6G; 2.10A {Escherichia coli} SCOP: d.128.1.4 PDB: 1v4g_A* 2d32_A* 2d33_A* Back     alignment and structure
>3ig5_A Glutamate-cysteine ligase; glutathione, ATP-grAsp, ATP-binding, glutathione biosynthesis, nucleotide-binding, phosphoprotein; HET: GLU PGE; 2.10A {Saccharomyces cerevisiae} PDB: 3ig8_A* 3lvv_A* 3lvw_A* Back     alignment and structure
>3nzt_A Glutamate--cysteine ligase; structural genomics, center for structural genomics of infec diseases, csgid, alpha and beta proteins; HET: AMP; 2.00A {Francisella tularensis subsp} Back     alignment and structure
>1f52_A Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium} SCOP: d.15.9.1 d.128.1.1 PDB: 1f1h_A* 1fpy_A* 1lgr_A* 2lgs_A* 2gls_A Back     alignment and structure
>2bvc_A Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis} SCOP: d.15.9.1 d.128.1.1 PDB: 2wgs_A* 2whi_A* 1hto_A* 1htq_A* Back     alignment and structure
>2d3a_A Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Back     alignment and structure
>2j9i_A Glutamate-ammonia ligase domain-containing protein 1; 17.00A {Mus musculus} Back     alignment and structure
>3fky_A Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 457 glutamate--cysteine ligase [Candidatus Liberibacter asi
d1r8ga_368 d.128.1.3 (A:) Carboxylate-amine ligase YbdK {Escherich 6e-41
>d1r8ga_ d.128.1.3 (A:) Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 562]} Length = 368 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Glutamine synthetase/guanido kinase
superfamily: Glutamine synthetase/guanido kinase
family: Glutamate-cysteine ligase family 2 (GCS2)
domain: Carboxylate-amine ligase YbdK
species: Escherichia coli [TaxId: 562]
 Score =  162 bits (410), Expect = 6e-41
 Identities = 55/432 (12%), Positives = 119/432 (27%), Gaps = 73/432 (16%)

Query: 26  KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
              E F +G E E  + +   +             ++ A                  + N
Sbjct: 5   HVSEPFTLGIELEMQVVNPPGYDLSQDSSM-----LIDA------------------VKN 41

Query: 86  PLSKAGISIE-PGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKW 144
            ++   +  +     LEL+T   ++++Q  G+     +++ +   +  L I G G +P  
Sbjct: 42  KITAGEVKHDITESMLELATDVCRDINQAAGQFSAMQKVVLQAATDHHLEICGGGTHPFQ 101

Query: 145 KLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQ 204
           K     +    RY    +    +               V +  +S  D    L    +  
Sbjct: 102 KWQRQEVCDNERYQRTLENFGYLI-----QQATVFGQHVHVGCASGDDAIYLLHGLSRFV 156

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
           P   A+ A+SP+ +G    F S R  I+              + +   FE   +      
Sbjct: 157 PHFIALSAASPYMQGTDTRFASSRPNIFSAF---PDNGPMPWVSNWQQFEALFRCLSYTT 213

Query: 265 MYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR 324
           M   ++  + +   DI         ++ R+ +   TL                   L  R
Sbjct: 214 MIDSIK--DLH--WDIRPSPHFGT-VEVRVMDTPLTLSHA--VNMAGLIQATAHWLLTER 266

Query: 325 GADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRG 384
                  + +      +    Y    +    H                        T   
Sbjct: 267 PFKHQEKDYLLYKFNRFQACRYGLEGVITDPH------------------------TGDR 302

Query: 385 QSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRW 444
           + L +  +++L                    +  ++ L + + +    A  M        
Sbjct: 303 RPLTEDTLRLLEKIAPSAHKI--------GASSAIEALHRQVVSGLNEAQLMRDFVAD-- 352

Query: 445 GKSIDPCFEEYA 456
           G S+    +++ 
Sbjct: 353 GGSLIGLVKKHC 364


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target457 glutamate--cysteine ligase [Candidatus Liberibacter asi
d1r8ga_368 Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 100.0
d2d32a1518 Gamma-glutamylcysteine synthetase GshA {Escherichia col 99.58
d1f52a2368 Glutamine synthetase, C-terminal domain {Salmonella typ 97.56
d2bvca2374 Glutamine synthetase, C-terminal domain {Mycobacterium 97.53
>d1r8ga_ d.128.1.3 (A:) Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Glutamine synthetase/guanido kinase
superfamily: Glutamine synthetase/guanido kinase
family: Glutamate-cysteine ligase family 2 (GCS2)
domain: Carboxylate-amine ligase YbdK
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=413.83  Aligned_cols=353  Identities=14%  Similarity=0.126  Sum_probs=298.3

Q ss_pred             CCCCCCCEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCEECCCCCCCCCCEEEC-CCCCEEEE
Q ss_conf             98720355867776538747657848711223499999975552488646127841023345688703413-54202420
Q gi|254781161|r   25 IKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIE-PGGQLELS  103 (457)
Q Consensus        25 ~k~~~~~~IG~E~E~flvd~~~~~p~~~~~~~~i~~~L~~l~~~~~~~~~~~~~~~~~l~~~~~~~~it~e-p~~qlE~s  103 (457)
                      .+.++.++||+|+|+|+||+.+..++++.     .++|+.+.+..                  .+..|+.| +.+|||++
T Consensus         4 f~~~~~~tiGvE~E~~lvd~~~~~~~~~~-----~~ll~~~~~~~------------------~~~~i~~El~~~qiEl~   60 (368)
T d1r8ga_           4 FHVSEPFTLGIELEMQVVNPPGYDLSQDS-----SMLIDAVKNKI------------------TAGEVKHDITESMLELA   60 (368)
T ss_dssp             CCCCCTTCEEEEEEEEEEETTTTEECSCC-----HHHHTTTSSSC------------------SSSEEEECSSSSEEEEE
T ss_pred             CCCCCCCCEEEEEEEEEECCCCCCCCCCH-----HHHHHHHHCCC------------------CCCCCCCCCCCCEEEEC
T ss_conf             99999983489876543679987667757-----99999722224------------------68863104677669980


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             11010156778888887888787421038734210568788845420000013566666543211267888763134047
Q gi|254781161|r  104 TTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQV  183 (457)
Q Consensus       104 ~~~~~~~~e~~~~~~~~~~~l~~il~~~~~~~~~~g~~P~~~~~~~~~~~~~Ry~~m~~~~~~~g~~~~~mm~~tas~Qv  183 (457)
                      ++|+.++.++..++..++..+..++...++.++++|+||+..+.++.+++++||+.|..+++..+   .  |..+||+||
T Consensus        61 t~p~~~~~e~~~~l~~~~~~~~~~~~~~~~~~~~~g~~P~~~~~~~~~~~~~ry~~~~~~~~~~~---~--~~~~~g~hv  135 (368)
T d1r8ga_          61 TDVCRDINQAAGQFSAMQKVVLQAATDHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLI---Q--QATVFGQHV  135 (368)
T ss_dssp             CCSBSSHHHHHHHHHHHHHHHHHHHHHTTCEEECCSBCSSCCC----------------CCGGGG---C--SCCBCEEEE
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCHH---H--HHHHCCCCE
T ss_conf             77779999999999999999999876558752445752126722155775089999987427078---8--876425603


Q ss_pred             EECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHC
Q ss_conf             51478988999999999876567888743786558877874322688852027778865654457754199999998514
Q gi|254781161|r  184 SLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDI  263 (457)
Q Consensus       184 ~id~~~~~d~~~~~n~a~~l~P~llAL~aNSPf~~G~~~g~~s~R~~i~~~~d~~r~~~~~~~~~~~~~~e~y~~~~~~~  263 (457)
                      |+++.+++++++++|.++.++|+++|||||||||+|+++|+.|+|..+|++++..+   ++..|.++..|++|++.+++.
T Consensus       136 ~~~~~d~~~~~~~~~~~~~~~p~l~aL~anSP~~~G~~tg~~s~R~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~  212 (368)
T d1r8ga_         136 HVGCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNG---PMPWVSNWQQFEALFRCLSYT  212 (368)
T ss_dssp             EEECSSHHHHHHHHHHHHTTHHHHHHHHCCBCEETTEECSCSBCGGGGGTTSTTCS---SCCCCSSHHHHHHHHHHHTTS
T ss_pred             EECCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCCHHHHHCCCCCC---CCCCCCCHHHHHHHHHHHHHC
T ss_conf             11689999999999999998689988852866335867788677526775087656---543000112079999999855


Q ss_pred             CCEEECCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCEEECCCCCCC-HHHHHHHHHHHH
Q ss_conf             5316305875326678887885126432101365546677531123456643335501211578888-667555588898
Q gi|254781161|r  264 PMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGR-LENIFAVAAFWT  342 (457)
Q Consensus       264 ~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~d~~~~~~~~f~~~r~~~~IEiR~~Ds~P-~~~~~a~aAf~~  342 (457)
                      +.+....                               +.|++.|+     ...++|||+|++|++| ..+.++.++|+.
T Consensus       213 ~~~~~~~-------------------------------~~~~~vRp-----~~~~~~iEiR~~D~~p~~~~~~~~aa~~~  256 (368)
T d1r8ga_         213 TMIDSIK-------------------------------DLHWDIRP-----SPHFGTVEVRVMDTPLTLSHAVNMAGLIQ  256 (368)
T ss_dssp             SSCSSGG-------------------------------GCCCSEEE-----ETTTTEEEEEEEECCSSHHHHHHHHHHHH
T ss_pred             CCCCCCC-------------------------------EEEEECCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             6445677-------------------------------05631687-----64667421247899998899999756888


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCC------CCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             87653885443232023699999999999997631158668------830899999999999998985231245564588
Q gi|254781161|r  343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVR------GQSLKDIAIQILTFAHQGLKNRSAKNHLQEDET  416 (457)
Q Consensus       343 gl~~~~~~~~~~~~~~~~~~~~~~~~~~~~aar~Gl~a~~~------~~~~~~l~~~ll~~A~~GL~~r~~~~~~~~dE~  416 (457)
                      +++..+..  .........+++.++.|+|+|+|+|+++.+.      ..++.+++.+|++.+++||.++|        ++
T Consensus       257 ~l~~~l~~--~~~~~~~~~~~~~~~~n~~~aar~Gl~~~l~~~~~~~~~~~~~~~~~Ll~~~~~~l~~lg--------~~  326 (368)
T d1r8ga_         257 ATAHWLLT--ERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRRPLTEDTLRLLEKIAPSAHKIG--------AS  326 (368)
T ss_dssp             HHHHHHHH--HCCCCCCGGGGTTHHHHHHHHHHHGGGSEEECTTTCCEEEHHHHHHHHHHHSHHHHHHHT--------CH
T ss_pred             HHHHHHHH--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHCC--------CH
T ss_conf             78889986--178776404489999999988761444110006899676899999999999999999788--------98


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCHHHHHHHHC
Q ss_conf             9999999999838985899999871022188899988767
Q gi|254781161|r  417 IFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA  456 (457)
Q Consensus       417 ~yL~~l~~~i~~g~t~A~~~l~~y~~~~~~~i~~i~~~~~  456 (457)
                      .||+++++++++|+|+|+|+++.|++.  ++++.++.+++
T Consensus       327 ~~l~~l~~~v~~g~t~A~~lr~~~~~~--gsl~~~v~~~~  364 (368)
T d1r8ga_         327 SAIEALHRQVVSGLNEAQLMRDFVADG--GSLIGLVKKHC  364 (368)
T ss_dssp             HHHHHHHHHHHHCCCHHHHHHHHHHTT--CCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHCC--CCHHHHHHHHH
T ss_conf             999999999982999999999999818--99999999999



>d2d32a1 d.128.1.4 (A:1-518) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f52a2 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bvca2 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 457 glutamate--cysteine ligase [Candidatus Liberibacte
2gwd_A_1-422422 (A:1-422) Glutamate cysteine ligase; disulfide bri 1e-74
1r8g_A_372 (A:) Hypothetical protein YBDK; structural genomic 2e-60
>2gwd_A (A:1-422) Glutamate cysteine ligase; disulfide bridges, glutathione biosynthesis, beta-hairpin, redox regulation; HET: GLU; 2.09A {Brassica juncea} PDB: 2gwc_A*Length = 422 Back     alignment and structure
 Score =  274 bits (702), Expect = 1e-74
 Identities = 189/422 (44%), Positives = 259/422 (61%), Gaps = 12/422 (2%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
             T   + +DL+ ++ASG K +E++RIGTEHE F F     RP+ YD    I  +L +I 
Sbjct: 11  VATEPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQ---IAELLNSIA 67

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
           ++  W+++M+   IIGL        IS+EPGGQ ELS   L+ +HQ   E+  ++  +K 
Sbjct: 68  ERFEWEKVMEGDKIIGLKQGKQ--SISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKA 125

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           + + + +G LGMGF PKW+ +++P MPK RY +M+ YMP+VG+ GLDMM RTCT QV+LD
Sbjct: 126 VAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLD 185

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           FSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+
Sbjct: 186 FSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFV 245

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D+  FE Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L     E  PT  DWEN
Sbjct: 246 FDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLPGE-LPTYNDWEN 304

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HL+T+FP VRL+  +EMRGAD G    + A+ AFW G+LYD   LQ+   LT+ W+  + 
Sbjct: 305 HLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAER 364

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
             L N VP  G+++  R   LK +A  +L  A  GL+           E  FL  + +++
Sbjct: 365 EMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLE------RRGYKEVGFLNAVTEVV 418

Query: 427 HN 428
             
Sbjct: 419 RT 420


>1r8g_A (A:) Hypothetical protein YBDK; structural genomics, unknown function, carboxylate-amine ligase, structure 2 function project, S2F; 2.15A {Escherichia coli}Length = 372 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target457 glutamate--cysteine ligase [Candidatus Liberibacter asi
2gwd_A_1-422422 Glutamate cysteine ligase; disulfide bridges, glut 100.0
1r8g_A_372 Hypothetical protein YBDK; structural genomics, un 100.0
1va6_A_19-156_243-337_461-481254 Glutamate--cysteine ligase; glutathione homeostasi 99.44
3ig5_A_42-340_446-692546 Glutamate-cysteine ligase; glutathione, ATP-grAsp, 99.06
1f52_A_99-399301 Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 97.97
2bvc_A_115-416302 Glutamine synthetase 1; ligase, transition state m 97.07
2ojw_A_129-384256 Glutamine synthetase; amino-acid biosynthesis, lig 97.9
2d3a_A_105-356252 Glutamine synthetase; ligase; HET: P3S ADP; 2.63A 97.71
3fky_A_107-370264 Glutamine synthetase; beta-grAsp, catalytic domain 97.71
>2gwd_A (A:1-422) Glutamate cysteine ligase; disulfide bridges, glutathione biosynthesis, beta-hairpin, redox regulation; HET: GLU; 2.09A {Brassica juncea} PDB: 2gwc_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=485.20  Aligned_cols=417  Identities=46%  Similarity=0.844  Sum_probs=393.3

Q ss_pred             CCCCCCCCHHHCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCE
Q ss_conf             98774331121489999999983798720355867776538747657848711223499999975552488646127841
Q gi|254781161|r    1 MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNI   80 (457)
Q Consensus         1 ~~~~~~~~~~~~~~~~l~~~f~~g~k~~~~~~IG~E~E~flvd~~~~~p~~~~~~~~i~~~L~~l~~~~~~~~~~~~~~~   80 (457)
                      |+..-.++.+.+++++|+++|++|+|+.+++++|+|+|+++||.++..++++.+   +..+|+.|...++++++...+..
T Consensus         5 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~GiE~E~~~Vd~~~~~~~~~~~---~~~~l~~L~~~~~~~~~~~~~~~   81 (422)
T 2gwd_A            5 PTEEAVVATEPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQ---IAELLNSIAERFEWEKVMEGDKI   81 (422)
T ss_dssp             ---------CCCCHHHHHHHHHTTCCCGGGCCEEEEEEEEEEETTTCCBCCHHH---HHHHHHHHHHHHTCEEEEETTEE
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCHHH---HHHHHHHHHHHCCCCEECCCCCE
T ss_conf             877655568988999999999837888456758986661466679897798377---99999999987398531368855


Q ss_pred             ECCCCCCCCCCEEECCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCHHHHHCCHHHHHHHH
Q ss_conf             02334568870341354202420110101567788888878887874210387342105687888454200000135666
Q gi|254781161|r   81 IGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLM  160 (457)
Q Consensus        81 ~~l~~~~~~~~it~ep~~qlE~s~~~~~~~~e~~~~~~~~~~~l~~il~~~~~~~~~~g~~P~~~~~~~~~~~~~Ry~~m  160 (457)
                      +.+..  +....+.++.+|+|++++|+.++.++++++..++..+..++...|..++++|+||+..+.+..++++.||+.|
T Consensus        82 ~~~~~--~~~~~~e~~~~qiE~~t~p~~~~~~l~~~l~~~~~~l~~~~~~~g~~l~~~g~~P~~~~~~~~~~~~~ry~~l  159 (422)
T 2gwd_A           82 IGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIM  159 (422)
T ss_dssp             EEEEE--TTEEEEECTTCCEEEECCCBSSHHHHHHHHHHHHHHHHHHHHHHTEEEECCSBCSSCCGGGSCCCSCHHHHHH
T ss_pred             EEECC--CCCEECCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             54337--9964512799668971567688999999999999999999986381011355344567444655567216789


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCC
Q ss_conf             66543211267888763134047514789889999999998765678887437865588778743226888520277788
Q gi|254781161|r  161 KKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT  240 (457)
Q Consensus       161 ~~~~~~~g~~~~~mm~~tas~Qv~id~~~~~d~~~~~n~a~~l~P~llAL~aNSPf~~G~~~g~~s~R~~i~~~~d~~r~  240 (457)
                      ..++..++..+..||.++|++|||+++.+++++++++|.+..+.|+++||||||||+.|+.+|+.|+|..+|++++..++
T Consensus       160 ~~~~~~~~~~~~~~~~~~~~~qv~~~~~~~~~~~~~~~~~~~~~p~l~aL~anSP~~~G~~~~~~s~R~~~~~~~d~~~~  239 (422)
T 2gwd_A          160 RNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRT  239 (422)
T ss_dssp             HHHGGGTCSSHHHHHHHBCEEEEEECCSSHHHHHHHHHHHHHHHHHHHHHHCCBCEETTEECSCSBHHHHHTTSSCGGGC
T ss_pred             HHHHHHHCCCCCHHHHCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCC
T ss_conf             99998505644034530022054268886788999999999987799999855865357887505488999873443345


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCC
Q ss_conf             65654457754199999998514531630587532667888788512643210136554667753112345664333550
Q gi|254781161|r  241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC  320 (457)
Q Consensus       241 ~~~~~~~~~~~~~e~y~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~d~~~~~~~~f~~~r~~~~  320 (457)
                      +..+..+.++.+|++|++++++++.++...+..+.......+.+++..... ....+.++..+|..|+++.|+++|+|+|
T Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~p~~~~~~~~~st~~~~~r~~~~  318 (422)
T 2gwd_A          240 GMLPFVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLP-CLPGELPTYNDWENHLTTIFPEVRLKRY  318 (422)
T ss_dssp             SCCGGGGSTTCSHHHHHHHHHHSCEEEEEETTEEEEEEEECHHHHHTTCCT-TSTTCCCCHHHHHHHHTTCCCSEEESSS
T ss_pred             CCCCCCCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCHHHHCCCCCC-CCCCCCCHHHHHHHHHHCCCCCCCCCCC
T ss_conf             554334787755899999986054212126766204688657764045665-5566541588998642035764343450


Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             12115788886675555888988765388544323202369999999999999763115866883089999999999999
Q gi|254781161|r  321 LEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQ  400 (457)
Q Consensus       321 IEiR~~Ds~P~~~~~a~aAf~~gl~~~~~~~~~~~~~~~~~~~~~~~~~~~~aar~Gl~a~~~~~~~~~l~~~ll~~A~~  400 (457)
                      ||+|++|+||.+...+.+|++.+|++....+......++.++++.+.+|+++|+|+|+++.+.++++++++.++++++++
T Consensus       319 IE~R~~D~~p~~~~~a~~a~~~~ll~~~~~~~~~~~~~~~~~~~~~~~n~~~a~r~Gl~a~~~~~~~~~~~~~ll~~~~~  398 (422)
T 2gwd_A          319 MEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKD  398 (422)
T ss_dssp             EEEEEEECCCHHHHHHHHHHHHHHHSSHHHHHHHHHHTTTCCHHHHHHHHHHHHHHGGGSEETTEEHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             13402346871110366067788774068777677665002699999999999985307876886499999999999999


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             89852312455645889999999999838
Q gi|254781161|r  401 GLKNRSAKNHLQEDETIFLKPLEKIIHNN  429 (457)
Q Consensus       401 GL~~r~~~~~~~~dE~~yL~~l~~~i~~g  429 (457)
                      ||+.+|.      +|+.||++|++++++|
T Consensus       399 ~l~~~g~------~~~~~l~~l~~~l~~G  421 (422)
T 2gwd_A          399 GLERRGY------KEVGFLNAVTEVVRTG  421 (422)
T ss_dssp             HHHHHTS------CCGGGGHHHHHHHHHT
T ss_pred             HHHHCCC------CHHHHHHHHHHHHHCC
T ss_conf             9998399------7599999999999849



>1r8g_A (A:) Hypothetical protein YBDK; structural genomics, unknown function, carboxylate-amine ligase, structure 2 function project, S2F; 2.15A {Escherichia coli} Back     alignment and structure
>1va6_A (A:19-156,A:243-337,A:461-481) Glutamate--cysteine ligase; glutathione homeostasis, beta barrel, peptide synthesis, transition state analogue; HET: P2S ADP P6G; 2.10A {Escherichia coli} Back     alignment and structure
>3ig5_A (A:42-340,A:446-692) Glutamate-cysteine ligase; glutathione, ATP-grAsp, ATP-binding, glutathione biosynthesis, nucleotide-binding, phosphoprotein; HET: GLU PGE; 2.10A {Saccharomyces cerevisiae} PDB: 3ig8_A* Back     alignment and structure
>1f52_A (A:99-399) Glutamine synthetase; ADP, MPD, ligase; HET: ADP; 2.49A {Salmonella typhimurium} Back     alignment and structure
>2bvc_A (A:115-416) Glutamine synthetase 1; ligase, transition state mimic; HET: P3S ADP; 2.1A {Mycobacterium tuberculosis} Back     alignment and structure
>2ojw_A (A:129-384) Glutamine synthetase; amino-acid biosynthesis, ligase, structural genomics, structural genomics consortium, SGC; HET: ADP; 2.05A {Homo sapiens} PDB: 2qc8_A* 2uu7_A Back     alignment and structure
>2d3a_A (A:105-356) Glutamine synthetase; ligase; HET: P3S ADP; 2.63A {Zea mays} PDB: 2d3b_A* 2d3c_A* Back     alignment and structure
>3fky_A (A:107-370) Glutamine synthetase; beta-grAsp, catalytic domain, acetylation, cytoplasm, ligase, UBL conjugation; HET: FLC; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure