254781162

254781162

GCN5-related N-acetyltransferase

GeneID in NCBI database:8210187Locus tag:CLIBASIA_05345
Protein GI in NCBI database:254781162Protein Accession:YP_003065575.1
Gene range:-(1158491, 1159069)Protein Length:192aa
Gene description:GCN5-related N-acetyltransferase
COG prediction:[R] Predicted acetyltransferase
KEGG prediction:GCN5-related N-acetyltransferase
SEED prediction:Acetyltransferase (EC 2.3.1.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV
ccccccEEEEEEEccccEEEEEEEccccccEEEEEcccccHHHHHHHHHHHcccccHHHHHHHHHHccccccEEEEEEEEccEEEEEEEEEEEccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHcccEEcccccEEccccccHHHEEEEEcccccccccccEEEEccc
cccccccccccccccccEEEEccccccccEEEEEcccHccHHHHHHHHHHHccccHHHHHHHHHHccccccccEEEEEEcccEEEEEEEEEEEEEcccccEEccccccccHHHcccHHHHHHHHHHHHHHHccccEEEEEccccHHccccccccccccccccccccHHHEEEEEccccHccccccEEEEEcc
MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERlehdssicamhadsfgpGRFVRAAVLLREQGMHDLSLSFLCAEGKrivgsvrmtpiSIEKItghllgpivvhplyqnkgigrkLISMSVDAAEKKGSQVIVLVGDIAYysklgfqavpwkslilpapvdpnrvlFLPLVQNVAQNIKGIVRCREV
mhdnnielRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKitghllgpiVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV
MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV
****N*ELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE*
MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV
**DNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV
MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV
MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target192 GCN5-related N-acetyltransferase [Candidatus Liberibact
254780989185 GCN5-related N-acetyltransferase [Candidatus Liber 9e-13
>gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Back     alignment
 Score = 64.7 bits (156), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%)

Query: 74  LSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG 133
           +SF+C +G RIVG++R TPI I K  G L GP+ V   Y+ +GIG +L  MS  A +  G
Sbjct: 64  MSFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSG 123

Query: 134 SQVIVLVGDIAYYSKLGFQ 152
           ++ +++     ++  LGF+
Sbjct: 124 AEFVLIDAKHDWHKHLGFK 142

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target192 GCN5-related N-acetyltransferase [Candidatus Liberibact
315122547167 GCN5-related N-acetyltransferase [Candidatus Liberibact 1 2e-64
218671410223 probable acetyltransferase protein [Rhizobium etli GR56 1 3e-42
209550376166 GCN5-related N-acetyltransferase [Rhizobium leguminosar 1 7e-42
241205761180 GCN5-related N-acetyltransferase [Rhizobium leguminosar 1 9e-42
116253246166 acetyltransferase [Rhizobium leguminosarum bv. viciae 3 1 1e-41
190892801168 acetyltransferase [Rhizobium etli CIAT 652] Length = 16 1 1e-41
218514065223 probable acetyltransferase protein [Rhizobium etli 8C-3 1 2e-41
218509421225 probable acetyltransferase protein [Rhizobium etli Bras 1 2e-41
15966122183 hypothetical protein SMc02707 [Sinorhizobium meliloti 1 1 1e-39
159185126189 acetyltransferase [Agrobacterium tumefaciens str. C58] 1 2e-38
>gi|315122547|ref|YP_004063036.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 167 Back     alignment and organism information
 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 110/160 (68%), Positives = 139/160 (86%)

Query: 33  FFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTP 92
           FF E  +HDS+ICAMHA++FGPGRFVRAA+LLREQG HDLSLSFLCA+G++IVGSVRM P
Sbjct: 7   FFPETADHDSTICAMHAEAFGPGRFVRAAMLLREQGTHDLSLSFLCADGEKIVGSVRMMP 66

Query: 93  ISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152
           ISIEKI G++LGPIVVHPLY+NKGIG+KLI M++  A  KGS+V+VLVGD  YY+K+GFQ
Sbjct: 67  ISIEKIKGYMLGPIVVHPLYRNKGIGKKLIQMAIKGARTKGSEVVVLVGDADYYTKIGFQ 126

Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCREV 192
            VP+KSL+ P PV+P RV+F P+  N+ +N+KG++RCR+V
Sbjct: 127 KVPFKSLLFPVPVNPQRVMFYPIENNIVENLKGVIRCRKV 166


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218671410|ref|ZP_03521080.1| probable acetyltransferase protein [Rhizobium etli GR56] Length = 223 Back     alignment and organism information
>gi|209550376|ref|YP_002282293.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 166 Back     alignment and organism information
>gi|241205761|ref|YP_002976857.1| GCN5-related N-acetyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 180 Back     alignment and organism information
>gi|116253246|ref|YP_769084.1| acetyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 166 Back     alignment and organism information
>gi|190892801|ref|YP_001979343.1| acetyltransferase [Rhizobium etli CIAT 652] Length = 168 Back     alignment and organism information
>gi|218514065|ref|ZP_03510905.1| probable acetyltransferase protein [Rhizobium etli 8C-3] Length = 223 Back     alignment and organism information
>gi|218509421|ref|ZP_03507299.1| probable acetyltransferase protein [Rhizobium etli Brasil 5] Length = 225 Back     alignment and organism information
>gi|15966122|ref|NP_386475.1| hypothetical protein SMc02707 [Sinorhizobium meliloti 1021] Length = 183 Back     alignment and organism information
>gi|159185126|ref|NP_355216.2| acetyltransferase [Agrobacterium tumefaciens str. C58] Length = 189 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target192 GCN5-related N-acetyltransferase [Candidatus Liberibact
pfam0058380 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) fam 4e-08
cd0430165 cd04301, NAT_SF, N-Acyltransferase superfamily: Various 5e-07
PTZ00330147 PTZ00330, PTZ00330, acetyltransferase; Provisional 8e-06
TIGR01575131 TIGR01575, rimI, ribosomal-protein-alanine acetyltransf 5e-05
PRK07757152 PRK07757, PRK07757, acetyltransferase; Provisional 7e-05
COG0456177 COG0456, RimI, Acetyltransferases [General function pre 8e-04
KOG3396150 KOG3396, KOG3396, KOG3396, Glucosamine-phosphate N-acet 8e-04
PRK09491146 PRK09491, rimI, ribosomal-protein-alanine N-acetyltrans 0.001
COG1246153 COG1246, ArgA, N-acetylglutamate synthase and related a 0.004
COG3153171 COG3153, COG3153, Predicted acetyltransferase [General 1e-30
>gnl|CDD|144249 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family Back     alignment and domain information
>gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>gnl|CDD|140351 PTZ00330, PTZ00330, acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|162430 TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>gnl|CDD|181103 PRK07757, PRK07757, acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30804 COG0456, RimI, Acetyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|38606 KOG3396, KOG3396, KOG3396, Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|181904 PRK09491, rimI, ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31439 COG1246, ArgA, N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|32967 COG3153, COG3153, Predicted acetyltransferase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 192 GCN5-related N-acetyltransferase [Candidatus Liberibact
COG3153171 Predicted acetyltransferase [General function predictio 100.0
PRK09491144 rimI ribosomal-protein-alanine N-acetyltransferase; Pro 99.69
TIGR01575140 rimI ribosomal-protein-alanine acetyltransferase; Inter 99.61
PRK09831147 hypothetical protein; Provisional 99.34
PRK10314153 hypothetical protein; Provisional 99.33
PRK10562145 hypothetical protein; Provisional 99.31
COG0456177 RimI Acetyltransferases [General function prediction on 99.21
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. 99.21
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransferase 98.8
COG4552 389 Eis Predicted acetyltransferase involved in intracellul 98.67
KOG3234173 consensus 98.02
KOG3138187 consensus 97.98
TIGR03243 335 arg_catab_AOST arginine and ornithine succinyltransfera 96.25
PRK03624140 putative acetyltransferase; Provisional 99.74
PRK07757152 acetyltransferase; Provisional 99.74
PTZ00330147 acetyltransferase; Provisional 99.65
PRK07922170 N-acetylglutamate synthase; Validated 99.64
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Provisio 99.63
PRK10140162 putative acetyltransferase YhhY; Provisional 99.59
PRK05279441 N-acetylglutamate synthase; Validated 99.5
PRK01346 411 hypothetical protein; Provisional 99.46
COG1246153 ArgA N-acetylglutamate synthase and related acetyltrans 99.43
PRK10975231 TDP-fucosamine acetyltransferase; Provisional 99.41
KOG3139165 consensus 99.4
PRK12308614 bifunctional argininosuccinate lyase/N-acetylglutamate 99.39
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransferase 99.23
PRK10514146 hypothetical protein; Provisional 99.2
COG1247169 Sortase and related acyltransferases [Cell envelope bio 99.03
KOG3397225 consensus 98.97
KOG3216163 consensus 98.94
TIGR01890439 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro 98.88
KOG4144190 consensus 98.46
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; Provi 98.24
KOG3235193 consensus 98.16
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; Prov 98.1
TIGR02382201 wecD_rffC TDP-D-fucosamine acetyltransferase; InterPro: 97.46
pfam04958 338 AstA Arginine N-succinyltransferase beta subunit. Argin 96.96
TIGR03245 336 arg_AOST_alph arginine/ornithine succinyltransferase, a 96.94
PRK00756196 acyltransferase NodA; Provisional 96.87
PRK10456 344 arginine succinyltransferase; Provisional 96.65
TIGR03244 336 arg_catab_AstA arginine N-succinyltransferase. In many 96.48
pfam02474196 NodA Nodulation protein A (NodA). Rhizobia nodulation ( 96.43
COG3375266 Uncharacterized conserved protein [Function unknown] 95.35
COG3916209 LasI N-acyl-L-homoserine lactone synthetase [Signal tra 93.47
pfam01233162 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-ter 92.73
pfam09390161 DUF1999 Protein of unknown function (DUF1999). This fam 92.7
TIGR01686337 FkbH FkbH domain; InterPro: IPR010037 This entry descri 90.81
KOG2779 421 consensus 90.31
cd0430183 GNAT GCN5-related N-acetyltransferases (GNAT) represent 99.46
pfam0058380 Acetyltransf_1 Acetyltransferase (GNAT) family. This fa 99.32
COG2153155 ElaA Predicted acyltransferase [General function predic 99.19
pfam0844586 FR47 FR47-like protein. The members of this family are 98.88
KOG2488202 consensus 98.49
COG3393268 Predicted acetyltransferase [General function predictio 98.41
KOG3396150 consensus 98.32
TIGR01211573 ELP3 histone acetyltransferase, ELP3 family; InterPro: 98.26
TIGR02406162 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferas 98.08
COG1670187 RimL Acetyltransferases, including N-acetylases of ribo 98.02
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transferase 97.99
COG3981174 Predicted acetyltransferase [General function predictio 97.93
cd02169 296 Citrate_lyase_ligase Citrate lyase ligase, also known a 97.86
COG238899 Predicted acetyltransferase [General function predictio 97.84
pfam00765182 Autoind_synth Autoinducer synthetase. 97.55
PHA00673154 acetyltransferase domain containing protein 97.5
COG1243515 ELP3 Histone acetyltransferase [Transcription / Chromat 97.4
COG3053 352 CitC Citrate lyase synthetase [Energy production and co 97.37
PRK13688157 hypothetical protein; Provisional 96.92
COG3818167 Predicted acetyltransferase, GNAT superfamily [General 95.97
KOG2535554 consensus 95.76
PHA01807145 hypothetical protein 95.51
COG2401 593 ABC-type ATPase fused to a predicted acetyltransferase 95.2
pfam01853189 MOZ_SAS MOZ/SAS family. This region of these proteins h 94.33
COG5628143 Predicted acetyltransferase [General function predictio 93.02
PTZ00064442 histone acetyltransferase; Provisional 92.8
KOG2747396 consensus 92.46
KOG4135185 consensus 92.19
COG1444 758 Predicted P-loop ATPase fused to an acetyltransferase [ 98.13
pfam0844489 Gly_acyl_tr_C Aralkyl acyl-CoA:amino acid N-acyltransfe 95.28
COG0454156 WecD Histone acetyltransferase HPA2 and related acetylt 96.91
PRK13834207 putative autoinducer synthesis protein; Provisional 96.52
KOG3698891 consensus 93.0
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase; InterPro: IPR006464 Histone acetylation is carried out by a class of enzymes known as histone acetyltransferases (HATs), which catalyse the transfer of an acetyl group from acetyl-CoA to the lysine E-amino groups on the N-terminal tails of histones Back     alignment and domain information
>PRK09831 hypothetical protein; Provisional Back     alignment and domain information
>PRK10314 hypothetical protein; Provisional Back     alignment and domain information
>PRK10562 hypothetical protein; Provisional Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] Back     alignment and domain information
>KOG3234 consensus Back     alignment and domain information
>KOG3138 consensus Back     alignment and domain information
>TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>KOG3139 consensus Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK10514 hypothetical protein; Provisional Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3397 consensus Back     alignment and domain information
>KOG3216 consensus Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro: IPR010167 This entry represents a clade of amino-acid N-acetyltransferases, or N-acetylglutamate synthase, which is the product of the argA gene and the first enzyme in arginine biosynthesis Back     alignment and domain information
>KOG4144 consensus Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>KOG3235 consensus Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase; InterPro: IPR012752 This entry represents the WecD protein (formerly RffC) for the biosynthesis of enterobacterial common antigen (ECA), an outer leaflet, outer membrane glycolipid with a trisaccharide repeat unit Back     alignment and domain information
>pfam04958 AstA Arginine N-succinyltransferase beta subunit Back     alignment and domain information
>TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit Back     alignment and domain information
>PRK00756 acyltransferase NodA; Provisional Back     alignment and domain information
>PRK10456 arginine succinyltransferase; Provisional Back     alignment and domain information
>TIGR03244 arg_catab_AstA arginine N-succinyltransferase Back     alignment and domain information
>pfam02474 NodA Nodulation protein A (NodA) Back     alignment and domain information
>COG3375 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>pfam01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain Back     alignment and domain information
>pfam09390 DUF1999 Protein of unknown function (DUF1999) Back     alignment and domain information
>TIGR01686 FkbH FkbH domain; InterPro: IPR010037 This entry describes a domain of unknown function Back     alignment and domain information
>KOG2779 consensus Back     alignment and domain information
>cd04301 GNAT GCN5-related N-acetyltransferases (GNAT) represent a large superfamily of functionally diverse enzymes that catalyze the transfer of an acetyl group from acetyl-Coenzyme A to the primary amine of a wide range of acceptor substrates Back     alignment and domain information
>pfam00583 Acetyltransf_1 Acetyltransferase (GNAT) family Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>pfam08445 FR47 FR47-like protein Back     alignment and domain information
>KOG2488 consensus Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG3396 consensus Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family; InterPro: IPR005910 Histone acetylation is carried out by a class of enzymes known as histone acetyltransferases (HATs), which catalyse the transfer of an acetyl group from acetyl-CoA to the lysine E-amino groups on the N-terminal tails of histones Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase; InterPro: IPR012772 This enzyme family is the EctA of ectoine biosynthesis Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase, also known as [Citrate (pro-3S)-lyase] ligase, is responsible for acetylation of the (2-(5''-phosphoribosyl)-3'-dephosphocoenzyme-A) prosthetic group of the gamma subunit of citrate lyase, converting the inactive thiol form of this enzyme to the active form Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>pfam00765 Autoind_synth Autoinducer synthetase Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] Back     alignment and domain information
>KOG2535 consensus Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>pfam01853 MOZ_SAS MOZ/SAS family Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>KOG2747 consensus Back     alignment and domain information
>KOG4135 consensus Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>pfam08444 Gly_acyl_tr_C Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>PRK13834 putative autoinducer synthesis protein; Provisional Back     alignment and domain information
>KOG3698 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target192 GCN5-related N-acetyltransferase [Candidatus Liberibact
1z4e_A153 Crystal Structure Of Transcriptional Regulator From 3e-06
2x7b_A168 Crystal Structure Of The N-Terminal Acetylase Ard1 2e-04
2fe7_A166 The Crystal Structure Of A Probable N-Acetyltransfe 5e-04
1wwz_A159 Crystal Structure Of Ph1933 From Pyrococcus Horikos 4e-06
2cnm_A160 Rimi - Ribosomal S18 N-Alpha-Protein Acetyltransfer 2e-04
3fb3_A161 Crystal Structure Of Trypanosoma Brucei Acetyltrans 6e-04
1y9k_A157 Iaa Acetyltransferase From Bacillus Cereus Atcc 145 0.001
2atr_A138 Acetyltransferase, Gnat Family Protein Sp0256 From 0.004
gi|71042161|pdb|1Z4E|A Chain A, Crystal Structure Of Transcriptional Regulator From Bacillus Halodurans C-125 Length = 153 Back     alignment and structure
 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 59/159 (37%), Gaps = 39/159 (24%)

Query: 34  FLERLEHDSSICA----MHADSFGPGRFVRAAVLLREQGMHDLSLSFL------------ 77
              R   +  +      +  D  G           RE+    L +S++            
Sbjct: 5   VTIREATEGDLEQMVHMLADDVLG---------RKRERYEKPLPVSYVRAFKEIKKDKNN 55

Query: 78  ----CAEGKRIVGSVRMT---PISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAE 130
                  G+ IVG +++T    ++ +      +  +  H   + +GIG +L+  +++ A+
Sbjct: 56  ELIVACNGEEIVGMLQVTFTPYLTYQGSWRATIEGVRTHSAARGQGIGSQLVCWAIERAK 115

Query: 131 KKGSQVIVLVGDI------AYYSKLGFQAVPWKSLILPA 163
           ++G  +I L  D        +Y +LGF+    + L +  
Sbjct: 116 ERGCHLIQLTTDKQRPDALRFYEQLGFK-ASHEGLKMHF 153


>gi|301015706|pdb|2X7B|A Chain A, Crystal Structure Of The N-Terminal Acetylase Ard1 From Sulfolobus Solfataricus P2 Length = 168 Back     alignment and structure
>gi|88192965|pdb|2FE7|A Chain A, The Crystal Structure Of A Probable N-Acetyltransferase From Pseudomonas Aeruginosa Length = 166 Back     alignment and structure
gi|60593940|pdb|1WWZ|A Chain A, Crystal Structure Of Ph1933 From Pyrococcus Horikoshii Ot3 Length = 159 Back     alignment and structure
>gi|149241050|pdb|2CNM|A Chain A, Rimi - Ribosomal S18 N-Alpha-Protein Acetyltransferase In Complex With A Bisubstrate Inhibitor (Cterm-Arg-Arg-Phe- Tyr-Arg-Ala-N-Alpha-Acetyl-S-Coa). Length = 160 Back     alignment and structure
>gi|215261504|pdb|3FB3|A Chain A, Crystal Structure Of Trypanosoma Brucei Acetyltransferase, Tb11.01.2886 Length = 161 Back     alignment and structure
>gi|60594182|pdb|1Y9K|A Chain A, Iaa Acetyltransferase From Bacillus Cereus Atcc 14579 Length = 157 Back     alignment and structure
>gi|82407887|pdb|2ATR|A Chain A, Acetyltransferase, Gnat Family Protein Sp0256 From Streptococcus Pneumoniae Tigr4 Length = 138 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target192 GCN5-related N-acetyltransferase [Candidatus Liberibact
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding moti 2e-09
2hv2_A 400 Hypothetical protein; PSI, protein structure initiative 1e-08
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwich, s 2e-08
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structural gen 5e-08
2i00_A 406 Acetyltransferase, GNAT family; structural genomics, PS 8e-08
3frm_A254 Uncharacterized conserved protein; APC61048, structural 9e-08
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, structural 3e-07
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzyme-inh 8e-07
1sqh_A312 Hypothetical protein CG14615-PA; structural genomics, P 9e-07
2gan_A190 182AA long hypothetical protein; alpha-beta protein., s 2e-06
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GCN5-re 2e-06
2ozh_A142 Hypothetical protein XCC2953; NP_638301.1, structural g 3e-06
3mgd_A157 Predicted acetyltransferase; structural genomics, PSI-2 3e-06
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu tern 5e-06
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyltrans 4e-05
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A putat 4e-05
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate synthas 4e-05
3ey5_A181 Acetyltransferase-like, GNAT family; structural genomic 5e-05
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {B 8e-05
3i3g_A161 N-acetyltransferase; malaria, structural genomics, stru 1e-04
3ec4_A228 Putative acetyltransferase from the GNAT family; YP_497 1e-04
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltransfera 2e-04
3exn_A160 Probable acetyltransferase; GCN5-related N-acetyltransf 2e-04
1vkc_A158 Putative acetyl transferase; structural genomics, south 2e-04
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/ 3e-04
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE, ace 3e-04
1on0_A158 YYCN protein; structural genomics, alpha-beta protein w 3e-04
2cy2_A174 TTHA1209, probable acetyltransferase; structural genomi 4e-04
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic bios 0.003
3lod_A162 Putative acyl-COA N-acyltransferase; structural genomic 9e-04
1xeb_A150 Hypothetical protein PA0115; midwest center for structu 0.002
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, acetyltr 0.004
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, acyl 0.004
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, anti 6e-06
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic bios 8e-04
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, putat 7e-06
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 1.80 4e-05
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, stru 2e-04
3iwg_A276 Acetyltransferase, GNAT family; structural genomics, AP 3e-04
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-acetyl 8e-04
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase; acy 0.001
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP protein, 0.001
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, polyket 0.002
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron cass 0.002
2qec_A204 Histone acetyltransferase HPA2 and related acetyltransf 0.002
1u6m_A199 Acetyltransferase, GNAT family; structural genomics, PS 0.002
2fiw_A172 GCN5-related N- acetyltransferase:aminotransferase, cla 0.003
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural genom 0.003
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis H37RV} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Length = 181 Back     alignment and structure
 Score = 57.8 bits (139), Expect = 2e-09
 Identities = 22/149 (14%), Positives = 39/149 (26%), Gaps = 18/149 (12%)

Query: 39  EHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKI 98
           E    I  M   +F  G F          GMH      L      I+    +    +   
Sbjct: 19  ETRQDIRQMVTGAF-AGDFTETDWEHTLGGMH-----ALIWHHGAIIAHAAVIQRRLIYR 72

Query: 99  TGHL----LGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD--IAYYSKLGFQ 152
              L    +  + V   ++ + +   L+               +         Y+  G+ 
Sbjct: 73  GNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWL 132

Query: 153 AVPWKSLIL------PAPVDPNRVLFLPL 175
                + +L        P D   V  LP+
Sbjct: 133 PWHGPTSVLAPTGPVRTPDDDGTVFVLPI 161


>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for structural genomics, MCSG, structural genomics; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 400 Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: COA; 2.25A {Pyrococcus horikoshii} Length = 288 Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.30A {Enterococcus faecalis V583} SCOP: d.106.1.4 d.108.1.10 Length = 406 Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis atcc 12228} Length = 254 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Length = 388 Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Length = 207 Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Length = 312 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein structure initiative; 2.10A {Pyrococcus horikoshii OT3} SCOP: d.108.1.1 Length = 190 Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Length = 140 Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; NP_638301.1, structural genomics, joint center for structural genomics, JCSG; 1.40A {Xanthomonas campestris PV} Length = 142 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456 Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics; HET: ACO; 1.66A {Escherichia coli CFT073} PDB: 2fs5_A* Length = 235 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase (GNAT) family; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, PSI-2, protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Length = 146 Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Length = 161 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, structural genomics, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans DSM12444} Length = 228 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD; HET: COA ACO; 1.60A {Mycobacterium tuberculosis H37RV} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Length = 318 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, PSI, structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus HB8} Length = 160 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Length = 183 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel beta strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus HB8} SCOP: d.108.1.1 PDB: 1wk4_A* Length = 174 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339 Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, protein structure initiative; 2.50A {Klebsiella pneumoniae subsp} Length = 162 Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural genomics, protein structure initiative, PSI; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Length = 150 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli K12} Length = 147 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339 Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase, structural genomics; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Length = 150 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Length = 166 Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiative; HET: MSE; 2.30A {Colwellia psychrerythraea 34H} Length = 276 Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190 Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Length = 163 Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketide synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula 19L} PDB: 2ref_A* Length = 224 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Length = 176 Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Length = 204 Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 199 Back     alignment and structure
>2fiw_A GCN5-related N- acetyltransferase:aminotransferase, class-II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase; HET: ACO; 2.35A {Rhodopseudomonas palustris CGA009} SCOP: d.108.1.1 Length = 172 Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* Length = 170 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target192 GCN5-related N-acetyltransferase [Candidatus Liberibact
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {B 99.74
2i00_A 406 Acetyltransferase, GNAT family; structural genomics, PS 99.73
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate synthas 99.7
1tiq_A180 Protease synthase and sporulation negative regulatory p 99.69
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu tern 99.68
2fiw_A172 GCN5-related N- acetyltransferase:aminotransferase, cla 99.68
2hv2_A 400 Hypothetical protein; PSI, protein structure initiative 99.68
3efa_A147 Putative acetyltransferase; structural genomics, PSI-2, 99.68
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, anti 99.67
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzyme-inh 99.67
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, structural 99.67
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral genomics 99.66
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, structur 99.66
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, acetyltr 99.65
2fe7_A166 Probable N-acetyltransferase; structural genomics, PSI, 99.65
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural genom 99.64
1y9w_A140 Acetyltransferase; structural genomics, protein structu 99.64
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, polyket 99.63
3i3g_A161 N-acetyltransferase; malaria, structural genomics, stru 99.62
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwich, s 99.61
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding moti 99.61
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural genomi 99.61
3jvn_A166 Acetyltransferase; alpha-beta protein, structural genom 99.61
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobu 99.6
2cy2_A174 TTHA1209, probable acetyltransferase; structural genomi 99.6
2cnt_A160 Modification of 30S ribosomal subunit protein S18; N-al 99.6
2fia_A162 Acetyltransferase; structural genomics, PSI, protein st 99.59
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structural gen 99.59
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron cass 99.59
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE, ace 99.58
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomics, PS 99.58
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, acetyltr 99.57
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 1.80 99.56
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; puta 99.56
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; struct 99.56
3mgd_A157 Predicted acetyltransferase; structural genomics, PSI-2 99.55
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-acetyltr 99.55
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, structural 99.55
3dr6_A174 YNCA; acetyltransferase, csgid target, essential gene, 99.54
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GCN5-re 99.54
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, RIMI 99.53
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, stru 99.53
1vhs_A175 Similar to phosphinothricin acetyltransferase; structur 99.52
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, COA, ribos 99.52
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, GNAT f 99.52
3kkw_A182 Putative uncharacterized protein; acetyltransferase, GN 99.51
1u6m_A199 Acetyltransferase, GNAT family; structural genomics, PS 99.51
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/ 99.5
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 famil 99.5
3fix_A183 N-acetyltransferase; termoplasma acidophilum, structura 99.5
1xeb_A150 Hypothetical protein PA0115; midwest center for structu 99.49
2i6c_A160 Putative acetyltransferase; GNAT family, structural gen 99.47
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, 99.47
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltransfe 99.46
1on0_A158 YYCN protein; structural genomics, alpha-beta protein w 99.46
3dsb_A157 Putative acetyltransferase; APC60368.2, structural geno 99.46
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransferase, 99.46
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coenzyme 99.45
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha-beta 99.44
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A, str 99.44
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; structural 99.43
2fl4_A149 Spermine/spermidine acetyltransferase; structural genom 99.43
3ey5_A181 Acetyltransferase-like, GNAT family; structural genomic 99.42
1wwz_A159 Hypothetical protein PH1933; structural genomics, riken 99.42
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, structural 99.41
2eui_A153 Probable acetyltransferase; dimer, structural genomics, 99.41
2ge3_A170 Probable acetyltransferase; structural genomics, PSI, p 99.4
3frm_A254 Uncharacterized conserved protein; APC61048, structural 99.38
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, structural 99.38
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, putative 99.37
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, structural 99.36
3exn_A160 Probable acetyltransferase; GCN5-related N-acetyltransf 99.35
2qec_A204 Histone acetyltransferase HPA2 and related acetyltransf 99.35
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic bios 99.35
3ec4_A228 Putative acetyltransferase from the GNAT family; YP_497 99.33
2b5g_A171 Diamine acetyltransferase 1; structural genomics, PSI, 99.3
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltr 99.3
3iwg_A276 Acetyltransferase, GNAT family; structural genomics, AP 99.29
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, acyl 99.29
1sqh_A312 Hypothetical protein CG14615-PA; structural genomics, P 99.27
3h4q_A188 Putative acetyltransferase; NP_371943.1, structural gen 99.24
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltransfera 99.1
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyltrans 98.98
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransferase, 98.97
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransferase, G 98.85
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062,meth 98.81
2qml_A198 BH2621 protein; NP_243487.1, uncharacterized protein BH 98.79
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, protein-pr 98.74
1yre_A197 Hypothetical protein PA3270; APC5563, midwest center fo 98.72
1s7k_A182 Acetyl transferase; GNAT, coenzyme A; 1.80A {Salmonella 98.63
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alpha sa 98.63
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroqu 98.56
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha/beta 98.38
2fck_A181 Ribosomal-protein-serine acetyltransferase, putative; s 98.33
3iu1_A 383 Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyl 96.77
2d4p_A141 Hypothetical protein TTHA1254; structural genomics, NPP 94.83
2wuu_A 421 N-myristoyltransferase; acyltransferase; HET: NHM; 1.42 94.61
1iyk_A 392 Myristoyl-COA:protein N-myristoyltransferase; HET: MYA 94.08
1rxt_A 496 Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; 93.94
3lod_A162 Putative acyl-COA N-acyltransferase; structural genomic 99.62
1y7r_A133 Hypothetical protein SA2161; structural genomics, prote 99.61
2ozh_A142 Hypothetical protein XCC2953; NP_638301.1, structural g 99.61
2g3a_A152 Acetyltransferase; ACETYLFTRANSFERASE, structural genom 99.5
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-acetyl 99.49
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1 99.48
1z4r_A168 General control of amino acid synthesis protein 5-like 99.48
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, putat 99.47
1ygh_A164 ADA4, protein (transcriptional activator GCN5); transcr 99.41
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A putat 99.4
2jlm_A182 Putative phosphinothricin N-acetyltransferase; methioni 99.35
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP protein, 99.31
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, acetyltr 99.2
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, acetyl 99.15
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic bios 98.97
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, legion 98.82
2zw5_A 301 Bleomycin acetyltransferase; dimer, two domains; HET: C 98.06
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enzyme, 98.05
2q04_A211 Acetoin utilization protein; ZP_00540088.1, structural 97.67
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, stru 99.5
2gan_A190 182AA long hypothetical protein; alpha-beta protein., s 99.5
1y9k_A157 IAA acetyltransferase; structural genomics, midwest cen 99.47
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase; acy 99.44
1vkc_A158 Putative acetyl transferase; structural genomics, south 99.42
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- acetyl 99.42
2aj6_A159 Hypothetical protein MW0638; acetyltransferase (GNAT) f 99.38
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase, COA 99.31
3owc_A188 Probable acetyltransferase; structural genomics, PSI-2, 99.13
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltransfera 98.95
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; PSI, 98.91
3eg7_A176 Spermidine N1-acetyltransferase; structural genomics, I 98.89
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltransfera 98.76
1nsl_A184 Probable acetyltransferase; structural genomics, hexame 98.71
2fsr_A195 Acetyltranferase; alpha-beta-sandwich, structural genom 98.25
3fbu_A168 Acetyltransferase, GNAT family; structural genomics, PS 98.2
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, autoi 98.05
3dns_A135 Ribosomal-protein-alanine acetyltransferase; MCSG, PSI, 98.04
3juw_A175 Probable GNAT-family acetyltransferase; structural geno 97.95
1xmt_A103 Putative acetyltransferase; structural genomics, protei 96.86
2p0w_A324 Histone acetyltransferase type B catalytic subunit; HAT 96.34
1bob_A320 HAT1, histone acetyltransferase; histone modification, 96.01
2ozu_A284 Histone acetyltransferase MYST3; structural genomics, s 95.88
1fy7_A278 ESA1 histone acetyltransferase; coenzyme A; HET: COA; 2 95.84
2ou2_A280 Histone acetyltransferase htatip; structural genomics, 95.68
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, structur 95.6
1yle_A 342 Arginine N-succinyltransferase, alpha chain; structural 97.49
1iic_A 422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccha 95.86
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
Probab=99.74  E-value=1.4e-16  Score=115.73  Aligned_cols=139  Identities=14%  Similarity=0.227  Sum_probs=103.0

Q ss_pred             EEEEECCHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCEEEEEEECCEEEEEEEEEEEEEC---CCCEEEEEEEEECC
Q ss_conf             344207989999999985389872100131103888876078999988989999998776118---82238997678851
Q gi|254781162|r   34 FLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIE---KITGHLLGPIVVHP  110 (192)
Q Consensus        34 ~~~R~e~~~di~ai~~~~fgpgr~~~~~~~lR~~~~~~~~lslVA~~~~~IVG~i~~~pv~~~---~~~~~~LgplaV~P  110 (192)
                      |.||.-..+|+.+|...++.|+...+.+...-  .....++.|+|..++++||++.+.+....   ....+-|..++|+|
T Consensus         2 i~Ir~i~~ed~~~lR~~vL~~~~~~~~~~~~~--d~~~~~~h~~a~~~~~lVg~~~~~~~~~~~~~~~~~~~l~~~~V~~   79 (146)
T 2jdc_A            2 IEVKPINAEDTYELRHRILRPNQPIEACMFES--DLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLE   79 (146)
T ss_dssp             CEEEEECGGGGHHHHHHHTCTTSCGGGGSCGG--GGSTTCEEEEEEETTEEEEEEEEEECCCTTSCCSSEEEEEEEEECT
T ss_pred             CEEEECCHHHHHHHHHHHHHCCCCCHHCCCCC--CCCCCCEEEEEEECCEEEEEEEEEECCCCCCCCCCEEEEEEEEEEH
T ss_conf             58999799999999999842899800133876--6787758999999999999999872466666788769999999937


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCEEEEEE---CHHHHHHCCCEECCCCCEECCCCCCHHHEEEEECC
Q ss_conf             1138995899999999999613884799840---86578742948746365366899995666984357
Q gi|254781162|r  111 LYQNKGIGRKLISMSVDAAEKKGSQVIVLVG---DIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLV  176 (192)
Q Consensus       111 ~~rg~GiG~~Li~~~l~~a~~~g~~~v~l~g---~~~yY~rfGF~~~~~~~l~~p~pv~~~~~l~l~L~  176 (192)
                      +|||+|+|++||+++++.|+++|+..+.+..   +..||+|+||+.+.. .+..+ ++.+..+|.+.|+
T Consensus        80 ~~rg~GiG~~Ll~~~~~~a~~~g~~~i~l~a~~~A~~fY~k~GF~~~g~-~f~~~-~~~~h~~M~K~l~  146 (146)
T 2jdc_A           80 GYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGE-VFDTP-PVGPHILMYKRIT  146 (146)
T ss_dssp             TSTTSSHHHHHHHHHHHHHHHTTCCEEEEEEEGGGHHHHHHTTCEEEEE-EEECT-TSCEEEEEEEECC
T ss_pred             HHHCCCHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEECC-EEECC-CCCCCEEEEEECC
T ss_conf             6614998999999999999984983899956699999999789989895-81029-9835389999889



>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.30A {Enterococcus faecalis V583} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>2fiw_A GCN5-related N- acetyltransferase:aminotransferase, class-II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase; HET: ACO; 2.35A {Rhodopseudomonas palustris CGA009} SCOP: d.108.1.1 Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for structural genomics, MCSG, structural genomics; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural genomics, joint center for structural genomics, JCSG; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransferase (GNAT) family, structural genomics, joint center for structural genomics; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, protein structure initiative, PSI, midwest center for structural genomics, MCSG; 1.90A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketide synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula 19L} PDB: 2ref_A* Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis H37RV} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure initiative; 2.01A {Streptococcus pneumoniae TIGR4} SCOP: d.108.1.1 Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.61A {Vibrio fischeri ES114} Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus HB8} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal protein, acetyltransferase; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis V583} SCOP: d.108.1.1 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structural genomics, PSI; HET: GOL; 2.19A {Enterococcus faecalis V583} SCOP: d.108.1.1 Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics; HET: MSE; 1.75A {Salmonella typhimurium} PDB: 3dr8_A* Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural genomics, PSI-2, protein structure initiative; 1.75A {Listeria innocua CLIP11262} Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.00A {Shigella flexneri 2a str} Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, COA, ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, protein structure initiative; 2.00A {Bacillus halodurans c-125} SCOP: d.108.1.1 Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure