254781181

254781181

hypothetical protein CLIBASIA_05440

GeneID in NCBI database:8210206Locus tag:CLIBASIA_05440
Protein GI in NCBI database:254781181Protein Accession:YP_003065594.1
Gene range:+(1180776, 1181033)Protein Length:85aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80-----
MHQPSFLVSYPLVAVVIRLILKNFGCPLKRIVKVQKQAKSLANASQKLTVDQIDNSIMFLYPEQRQELAKRYKEKYNDVLIHLPD
ccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHcccEEEEEEHHHHHHHHHHHHHHHHHHHEEccc
cccccEEEcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHcccHHHHccHHHHHHHHHHHHHHHccEEEEccc
mhqpsflvsyPLVAVVIRLILKNFGCPLKRIVKVQKQAKSLANASQKLTVDQIDNSIMFLYPEQRQELAKRYKEKYNDVLIHLPD
mhqpsflvSYPLVAVVIRLILKNFGCPLKRIVKVQKQAKSLanasqkltvdqidNSIMFLYPEQRQELAKRYKEKYNDVLIHLPD
MHQPSFLVSYPLVAVVIRLILKNFGCPLKRIVKVQKQAKSLANASQKLTVDQIDNSIMFLYPEQRQELAKRYKEKYNDVLIHLPD
***PSFLVSYPLVAVVIRLILKNFGCPLKRIVK***************TVDQIDNSIMFLYPEQR*******KEKYNDVLIHLP*
MHQPSFLVSYPLVAVVIRLILKNFGCPLKRIVKVQKQAKSLANASQKLTVDQIDNSIMFLYPEQRQELAKRYKEKYNDVLIHLPD
***PSFLVSYPLVAVVIRLILKNFGCPLKRIVKVQKQAKSLANASQKLTVDQIDNSIMFLYPEQRQELAKRYKEKYNDVLIHLPD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHQPSFLVSYPLVAVVIRLILKNFGCPLKRIVKVQKQAKSLANASQKLTVDQIDNSIMFLYPEQRQELAKRYKEKYNDVLIHLPD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target85 hypothetical protein CLIBASIA_05440 [Candidatus Liberib
25478118071 hypothetical protein CLIBASIA_05435 [Candidatus Li 3e-04
>gi|254781180|ref|YP_003065593.1| hypothetical protein CLIBASIA_05435 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Back     alignment
 Score = 34.7 bits (78), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 21/26 (80%)

Query: 46 QKLTVDQIDNSIMFLYPEQRQELAKR 71
          QK+TVDQI+N+I  L PE+R++L  R
Sbjct: 26 QKVTVDQINNAIASLIPEERRDLQDR 51

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00