254781180

254781180

hypothetical protein CLIBASIA_05435

GeneID in NCBI database:8210205Locus tag:CLIBASIA_05435
Protein GI in NCBI database:254781180Protein Accession:YP_003065593.1
Gene range:+(1180445, 1180660)Protein Length:71aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70-
MHSIHQSTNSCDLVNNEQLTEIEEPQKVTVDQINNAIASLIPEERRDLQDRMAKYSTRKLKPRGRVIFADD
cccHHcccccccccccHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccEEEccc
cccEccccccccccccccccccccccccEHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccEEEEEcc
mhsihqstnscdlvnneqlteieepqkVTVDQINNAIASLIPEERRDLQDRMAKYStrklkprgrvifadd
mhsihqstnscdlvnNEQLTEIEEPQKVTVDQINNAIaslipeerrdLQDRMakystrklkprgrvifadd
MHSIHQSTNSCDLVNNEQLTEIEEPQKVTVDQINNAIASLIPEERRDLQDRMAKYSTRKLKPRGRVIFADD
**********CDLVNNEQLTEIEEPQKVTVDQINNAIASLIPEERRD***********KLKPRGRVIFA**
***********DLVNNEQLTEIEEPQKVTVDQINNAIASLIPEERRDLQDRMAKYSTRKLKPRGRVIFADD
********NSCDLVNNEQLTEIEEPQKVTVDQINNAIASLIPEERRDLQDRMAKYSTRKLKPRGRVIFADD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHSIHQSTNSCDLVNNEQLTEIEEPQKVTVDQINNAIASLIPEERRDLQDRMAKYSTRKLKPRGRVIFADD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target71 hypothetical protein CLIBASIA_05435 [Candidatus Liberib
25478118185 hypothetical protein CLIBASIA_05440 [Candidatus Li 3e-04
25478122168 hypothetical protein CLIBASIA_05640 [Candidatus Li 0.024
>gi|254781181|ref|YP_003065594.1| hypothetical protein CLIBASIA_05440 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Back     alignment
 Score = 34.7 bits (78), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 21/26 (80%)

Query: 26 QKVTVDQINNAIASLIPEERRDLQDR 51
          QK+TVDQI+N+I  L PE+R++L  R
Sbjct: 46 QKLTVDQIDNSIMFLYPEQRQELAKR 71

>gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] Length = 68 Back     alignment
 Score = 28.5 bits (62), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 22/30 (73%)

Query: 23 EEPQKVTVDQINNAIASLIPEERRDLQDRM 52
          +EP+K+  DQ+ +A+  L  EE+++LQ ++
Sbjct: 22 DEPKKLNPDQLCDAVCRLTLEEQKELQTKV 51

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00