254781182

254781182

hypothetical protein CLIBASIA_05445

GeneID in NCBI database:8210207Locus tag:CLIBASIA_05445
Protein GI in NCBI database:254781182Protein Accession:YP_003065595.1
Gene range:-(1181659, 1181943)Protein Length:94aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG
ccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHcEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
cccccccEEEccccccccHHHHHHHHHHHHHHHHHHcccEEEEEccccEccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
mkddqgqrinfekcgmlsdrTRYLKQHNLIIEEIFEWsnfvriegnkavhegqssieesDECLEFVNLFCDIVFTLPALikekksthpnqsrdg
mkddqgqrinfekcgmlsdrTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFTLPalikekksthpnqsrdg
MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG
***************MLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFTLPAL***************
MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFTLPALIKEK***********
*****GQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAV**GQSSIEESDECLEFVNLFCDIVFTLPALIKEK***********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG
MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG
MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESDECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRDG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target94 hypothetical protein CLIBASIA_05445 [Candidatus Liberib
315122553246 hypothetical protein CKC_04025 [Candidatus Liberibacter 1 2e-20
254503691242 hypothetical protein SADFL11_3730 [Labrenzia alexandrii 1 8e-06
218688916224 hypothetical protein ECED1_1107 [Escherichia coli ED1a] 1 9e-06
188533144232 Hypothetical protein, probable Cecropin family protein 1 1e-04
212703623104 hypothetical protein DESPIG_01668 [Desulfovibrio piger 1 7e-04
123442587197 hypothetical protein YE2343 [Yersinia enterocolitica su 1 0.002
295688019237 hypothetical protein Cseg_0582 [Caulobacter segnis ATCC 2 1e-08
213971540221 hypothetical protein PSPTOT1_0852 [Pseudomonas syringae 2 5e-08
301386145201 hypothetical protein PsyrptM_26064 [Pseudomonas syringa 2 5e-08
330965893201 hypothetical protein PSYAC_14870 [Pseudomonas syringae 2 7e-08
>gi|315122553|ref|YP_004063042.1| hypothetical protein CKC_04025 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 246 Back     alignment and organism information
 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 70/93 (75%)

Query: 1   MKDDQGQRINFEKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQSSIEESD 60
           + DDQG+ I+F     L ++ + L++ NLI  E++EWSN +R+ GNKAVHEG++ IE+++
Sbjct: 154 ITDDQGKAIDFSNNINLKNKIKSLREQNLITRELYEWSNHIRLAGNKAVHEGEAHIEDAN 213

Query: 61  ECLEFVNLFCDIVFTLPALIKEKKSTHPNQSRD 93
           EC EFV+LFC I+FTLPALI++ K  + ++S +
Sbjct: 214 ECFEFVHLFCHILFTLPALIEQNKLINSDKSTE 246


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254503691|ref|ZP_05115842.1| hypothetical protein SADFL11_3730 [Labrenzia alexandrii DFL-11] Length = 242 Back     alignment and organism information
>gi|218688916|ref|YP_002397128.1| hypothetical protein ECED1_1107 [Escherichia coli ED1a] Length = 224 Back     alignment and organism information
>gi|188533144|ref|YP_001906941.1| Hypothetical protein, probable Cecropin family protein [Erwinia tasmaniensis Et1/99] Length = 232 Back     alignment and organism information
>gi|212703623|ref|ZP_03311751.1| hypothetical protein DESPIG_01668 [Desulfovibrio piger ATCC 29098] Length = 104 Back     alignment and organism information
>gi|123442587|ref|YP_001006564.1| hypothetical protein YE2343 [Yersinia enterocolitica subsp. enterocolitica 8081] Length = 197 Back     alignment and organism information
>gi|295688019|ref|YP_003591712.1| hypothetical protein Cseg_0582 [Caulobacter segnis ATCC 21756] Length = 237 Back     alignment and organism information
>gi|213971540|ref|ZP_03399651.1| hypothetical protein PSPTOT1_0852 [Pseudomonas syringae pv. tomato T1] Length = 221 Back     alignment and organism information
>gi|301386145|ref|ZP_07234563.1| hypothetical protein PsyrptM_26064 [Pseudomonas syringae pv. tomato Max13] Length = 201 Back     alignment and organism information
>gi|330965893|gb|EGH66153.1| hypothetical protein PSYAC_14870 [Pseudomonas syringae pv. actinidiae str. M302091] Length = 201 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target94 hypothetical protein CLIBASIA_05445 [Candidatus Liberib
PRK11448 1123 PRK11448, hsdR, type I restriction enzyme EcoKI subunit 1e-04
>gnl|CDD|183141 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 94 hypothetical protein CLIBASIA_05445 [Candidatus Liberib
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 98.9
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target94 hypothetical protein CLIBASIA_05445 [Candidatus Liberib
2hkt_A172 Putative transcriptional regulator; structural genomics 94.99
3brj_A175 Mannitol operon repressor; APC85967.1, MTLR, structural 94.89
>3brj_A Mannitol operon repressor; APC85967.1, MTLR, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.75A {Vibrio parahaemolyticus rimd 2210633} SCOP: a.285.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target94 hypothetical protein CLIBASIA_05445 [Candidatus Liberib
d3c8ga1168 Putative transcriptional regulator YggD {Shigella flexn 94.31
d3brja1167 Mannitol operon repressor MtlR {Vibrio parahaemolyticus 93.9
>d3c8ga1 a.285.1.1 (A:1-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
class: All alpha proteins
fold: MtlR-like
superfamily: MtlR-like
family: MtlR-like
domain: Putative transcriptional regulator YggD
species: Shigella flexneri [TaxId: 623]
Probab=94.31  E-value=0.083  Score=28.71  Aligned_cols=49  Identities=2%  Similarity=-0.157  Sum_probs=41.7

Q ss_pred             CCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCC---CCHHHHHH
Q ss_conf             44889999999998689998999999999997313206888---89899999
Q gi|254781182|r   13 KCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ---SSIEESDE   61 (94)
Q Consensus        13 k~g~l~dri~~L~~~g~I~~~i~~~~~~~R~~gN~a~H~g~---~~~edA~~   61 (94)
                      +-|+++-||+.++.=|+|++...+-++.+|...|..+|.++   |+.+....
T Consensus        63 PLg~~svrikL~~~LG~Is~~~y~Di~~~~~irn~~~h~~~~~~F~dd~i~~  114 (168)
T d3c8ga1          63 PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWD  114 (168)
T ss_dssp             TTCSHHHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHHTCCCCCTTSHHHHH
T ss_pred             CCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHH
T ss_conf             8346999999999948898899988999999999985488778978689999



>d3brja1 a.285.1.1 (A:6-172) Mannitol operon repressor MtlR {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target94 hypothetical protein CLIBASIA_05445 [Candidatus Liberib
3c8g_A_172 A Possible Transciptional Regulator Yggd {Shigella 95.78
3brj_A_175 Mannitol operon repressor; APC85967.1, MTLR, struc 95.09
>3c8g_A (A:) A Possible Transciptional Regulator Yggd {Shigella Flexneri 2a Str. 2457t} Back     alignment and structure
Probab=95.78  E-value=0.019  Score=34.67  Aligned_cols=53  Identities=2%  Similarity=-0.147  Sum_probs=43.5

Q ss_pred             CCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCC---CCHHHHHHHHH
Q ss_conf             544889999999998689998999999999997313206888---89899999999
Q gi|254781182|r   12 EKCGMLSDRTRYLKQHNLIIEEIFEWSNFVRIEGNKAVHEGQ---SSIEESDECLE   64 (94)
Q Consensus        12 ~k~g~l~dri~~L~~~g~I~~~i~~~~~~~R~~gN~a~H~g~---~~~edA~~ll~   64 (94)
                      -+-|+++-||+.++.=|+|++....-++.+|...|..+|.++   |+-+.....+.
T Consensus        65 GPLg~lsvRikL~y~LG~Is~~~y~Di~~~~kiRn~l~h~~~~~~F~d~~i~~~i~  120 (172)
T 3c8g_A           65 GPLDDIDVALRLIYALGXXDXWLYADITHFSQYWHYLNEQDETPGFADDITWDFIS  120 (172)
T ss_dssp             STTCSHHHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHHTCCCCCTTSHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHH
T ss_conf             67210889999999718998889998999999999861577777768878999988



>3brj_A (A:) Mannitol operon repressor; APC85967.1, MTLR, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.75A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure