254781186

254781186

hypothetical protein CLIBASIA_05465

GeneID in NCBI database:8210211Locus tag:CLIBASIA_05465
Protein GI in NCBI database:254781186Protein Accession:YP_003065599.1
Gene range:-(1184741, 1184878)Protein Length:45aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40-----
MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSVAD
ccccccccEEEEEEcccHHHHHHHHHHccccHHHHHHHHHHHccc
ccccccccEEEEEEccHHHHHHHHHHHccccHHHHHHcccccccc
MAHQYNPDAIVLYANGIGAVTANYlenlnyspiekilgqrssvad
MAHQYNPDAIVLYANGIGAVTANYLENLnyspiekilgqrssvad
MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSVAD
*****NPDAIVLYANGIGAVTANYLENLNYSPIEKIL*QR*****
MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKIL********
***QYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQ******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiii
iiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSVAD
MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSVAD
MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSVAD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target45 hypothetical protein CLIBASIA_05465 [Candidatus Liberib
254781215 511 putative phage terminase, large subunit [Candidatu 2e-06
>gi|254781215|ref|YP_003065628.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Back     alignment
 Score = 42.4 bits (98), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 1   MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSSV 43
           +  +Y PDAI++ AN  GA T +YLE L Y  + ++LGQ+ +V
Sbjct: 363 LVEKYRPDAIIIDANNTGARTCDYLEMLGYH-VYRVLGQKRAV 404

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target45 hypothetical protein CLIBASIA_05465 [Candidatus Liberib
317120722 516 putative phage terminase large subunit [Liberibacter ph 1 2e-04
>gi|317120722|gb|ADV02544.1| putative phage terminase large subunit [Liberibacter phage SC2] Length = 516 Back     alignment and organism information
 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 1   MAHQYNPDAIVLYANGIGAVTANYLENLNYSPIEKILGQRSS 42
           + ++YNPDAIV+  NGIG    +YL N+++  +E ILGQR S
Sbjct: 363 LINRYNPDAIVIDGNGIGGTVVSYLLNMHHISVEVILGQRRS 404


Species: Liberibacter phage SC2
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00