254781187

254781187

putative phage terminase, large subunit

GeneID in NCBI database:8210212Locus tag:CLIBASIA_05470
Protein GI in NCBI database:254781187Protein Accession:YP_003065600.1
Gene range:-(1184862, 1185965)Protein Length:367aa
Gene description:putative phage terminase, large subunit
COG prediction:none
KEGG prediction:putative phage terminase, large subunit
SEED prediction:terminase B protein, putative
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------
MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCPVGSSI
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccccEEEEEEEEEEEEEEcccccccccEEEEEEEEccccccccHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHcccHHHHHHEEEEEEEEccccHHHHHHHcccccEEEEEEEEccccccccccccccccEEEEEEEccccccccccccEEEEEEEcccccEEEEEEcccccccEEEEEEEccccccccEEEEEccccccccHHHHHHHHHHccccccEEEEEEEEcccccccccEEcHHHHHHHHHHHccccccccEEEcccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHcccHHHccc
cccHHcHHHHHHHHHHHHHcccccccccccEEcccccccHcccHHHHHcccHHHHHHHHHHHHHHHccccccccccHHHHHHHcccccccHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHcccccEEEEEEccccccccHHHHcccccccEEEEEEEccccccHHHHHHHHHHcccccccEEEEEEcccccccccEHHHcccccccccEEEEEccccccccHHHHHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHccHHHHccccEEEEEEEcccccccEEEEEccccEHHHHHHHHHHHHHHHccccccccccc
mprlistdQKLEQELHEMLMHAECVLSFKNFVMRffpwgikgkplehfsqphrwQLEFMEAVDVHchsnvnnsnptIFKCAIsagrgigkTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSmlphrhwfemqslslhpsgwYAELLEQsmgidskhytitcrtyseerpdtfvgphnthgmavfndeasgtpdiiNKSILGfftelnpnrfwimtsntrrlngwfydifnipledwkryqidtrtvegidsgfhegiisrygldsdvARIEILgqfpqqevnnfiphnyieeamsreaiddlyaplimgcdiageggdKTVVVFRRGNIIEHIFDWSAKLIQEtnqegcpvgssi
MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTvegidsgfhEGIISRYGLDSDVARIEILgqfpqqevnnFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLiqetnqegcpvgssi
MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCPVGSSI
************QELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCPVG***
MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQET***********
*PRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQ*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCPVGSSI
MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCPVGSSI
MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFMEAVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHNYIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEGCPVGSSI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target367 putative phage terminase, large subunit [Candidatus Lib
254781215 511 putative phage terminase, large subunit [Candidatu 1e-157
>gi|254781215|ref|YP_003065628.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Back     alignment
 Score =  545 bits (1403), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 252/359 (70%), Positives = 299/359 (83%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           M R + T+ + EQ+L +++   E  LSF NFV+ FFPWG KG PLE FS P  WQLEFME
Sbjct: 1   MSRELPTNPETEQKLFDLMWSDEIKLSFSNFVLHFFPWGEKGTPLEGFSAPRSWQLEFME 60

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
            VD HC ++VNN NP +FK AISAGRGIGKTTLNAW++LWL+STRPG+S+IC+ANSETQL
Sbjct: 61  VVDAHCLNSVNNPNPEVFKGAISAGRGIGKTTLNAWLVLWLMSTRPGISVICLANSETQL 120

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           K TLWAEVSKWLS+LP++HWFEMQSLSLHP+ WY+++L  S+GIDSKHY+  CRTYSEER
Sbjct: 121 KTTLWAEVSKWLSLLPNKHWFEMQSLSLHPAPWYSDVLHCSLGIDSKHYSTMCRTYSEER 180

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
           PDTFVG HNT+GMA+ NDEASGTPD+IN  ILGF TE N NRFWIMTSN RRL+G FY+I
Sbjct: 181 PDTFVGHHNTYGMAIINDEASGTPDVINLGILGFLTERNANRFWIMTSNPRRLSGKFYEI 240

Query: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
           FN PL+DWKR+QIDTRTVEGID  FHEGII+RYGLDSDV R+E+ GQFPQQ++++FIP N
Sbjct: 241 FNKPLDDWKRFQIDTRTVEGIDPSFHEGIIARYGLDSDVTRVEVCGQFPQQDIDSFIPLN 300

Query: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
            IEEA++RE   D YAPLIMGCDIA EGGD TVVV RRG +IEH+FDWS   ++ TN +
Sbjct: 301 IIEEALNREPCPDPYAPLIMGCDIAEEGGDNTVVVLRRGPVIEHLFDWSKTDLRTTNNK 359

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target367 putative phage terminase, large subunit [Candidatus Lib
315121940 509 putative phage terminase, large subunit [Candidatus Lib 1 1e-160
315122902 509 putative phage terminase, large subunit [Candidatus Lib 1 1e-159
317120722 516 putative phage terminase large subunit [Liberibacter ph 1 1e-155
254781215 511 putative phage terminase, large subunit [Candidatus Lib 1 1e-153
302120432255 putative phage terminase large subunit [Candidatus Libe 1 1e-115
167032754 499 putative phage terminase large subunit [Pseudomonas put 1 5e-39
323156136 491 terminase large subunit [Escherichia coli EPECa14] Leng 1 4e-35
212710820 493 hypothetical protein PROVALCAL_01888 [Providencia alcal 1 8e-35
303328395 500 conserved hypothetical protein [Desulfovibrio sp. 3_1_s 1 2e-34
268589373 493 conserved hypothetical protein [Providencia rettgeri DS 1 2e-34
>gi|315121940|ref|YP_004062429.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509 Back     alignment and organism information
 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 264/359 (73%), Positives = 303/359 (84%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           M R + T  + EQEL E++   +  LSF NFV+R FPW      L +FS+P RWQL+FME
Sbjct: 1   MTRELPTKIEHEQELMELMFSDDIKLSFTNFVLRLFPWSEANTSLANFSRPRRWQLDFME 60

Query: 61  AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL 120
           AVD  C  NV+N +P IFK A+SAGRGIGKTTLNAWMMLWLISTRPGMSI+C+ANSETQL
Sbjct: 61  AVDTDCLFNVDNPDPKIFKGAVSAGRGIGKTTLNAWMMLWLISTRPGMSILCLANSETQL 120

Query: 121 KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER 180
           K+TLWAEVSKWLSMLP++HWFEMQSLSLHP+ WYAE LE++ GIDSKHYTITCRTYSEER
Sbjct: 121 KSTLWAEVSKWLSMLPNKHWFEMQSLSLHPAVWYAEALEKNFGIDSKHYTITCRTYSEER 180

Query: 181 PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI 240
           PDTFVG HNT+GMA+FNDEASGTPD+IN SILGFFTE N NRFW+MTSN RRL GWFYDI
Sbjct: 181 PDTFVGHHNTYGMAIFNDEASGTPDVINTSILGFFTENNANRFWVMTSNPRRLKGWFYDI 240

Query: 241 FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN 300
           FN+PLEDW+R+QIDTRTVEGID  FHEGIISRYGLDSDV R+E+LGQFPQQ++N+FIP  
Sbjct: 241 FNVPLEDWQRFQIDTRTVEGIDPSFHEGIISRYGLDSDVTRVEVLGQFPQQDINSFIPFY 300

Query: 301 YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQE 359
            IEEA++RE I D YAPLIMGCDIAGEGGD TVVV RRG  IEHIFDWS   +  ++++
Sbjct: 301 RIEEALNREPIKDPYAPLIMGCDIAGEGGDNTVVVLRRGTNIEHIFDWSGLAVNASSRK 359


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122902|ref|YP_004063391.1| putative phage terminase, large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509 Back     alignment and organism information
>gi|317120722|gb|ADV02544.1| putative phage terminase large subunit [Liberibacter phage SC2] Length = 516 Back     alignment and organism information
>gi|254781215|ref|YP_003065628.1| putative phage terminase, large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Back     alignment and organism information
>gi|302120432|gb|ADK92426.1| putative phage terminase large subunit [Candidatus Liberibacter asiaticus] Length = 255 Back     alignment and organism information
>gi|167032754|ref|YP_001667985.1| putative phage terminase large subunit [Pseudomonas putida GB-1] Length = 499 Back     alignment and organism information
>gi|323156136|gb|EFZ42295.1| terminase large subunit [Escherichia coli EPECa14] Length = 491 Back     alignment and organism information
>gi|212710820|ref|ZP_03318948.1| hypothetical protein PROVALCAL_01888 [Providencia alcalifaciens DSM 30120] Length = 493 Back     alignment and organism information
>gi|303328395|ref|ZP_07358832.1| conserved hypothetical protein [Desulfovibrio sp. 3_1_syn3] Length = 500 Back     alignment and organism information
>gi|268589373|ref|ZP_06123594.1| conserved hypothetical protein [Providencia rettgeri DSM 1131] Length = 493 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target367 putative phage terminase, large subunit [Candidatus Lib
pfam03237 380 pfam03237, Terminase_6, Terminase-like family 2e-04
>gnl|CDD|146059 pfam03237, Terminase_6, Terminase-like family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 367 putative phage terminase, large subunit [Candidatus Lib
pfam03237 380 Terminase_6 Terminase-like family. This family represen 99.97
pfam04466 387 Terminase_3 Phage terminase large subunit. Initiation o 99.94
COG5323 410 Uncharacterized conserved protein [Function unknown] 99.44
COG1783 414 XtmB Phage terminase large subunit [General function pr 99.24
TIGR01547 462 phage_term_2 phage terminase, large subunit, PBSX famil 99.14
COG4373 509 Mu-like prophage FluMu protein gp28 [General function p 98.84
pfam03354 473 Terminase_1 Phage Terminase. The majority of the member 99.82
KOG0331519 consensus 95.74
COG4626 546 Phage terminase-like protein, large subunit [General fu 99.39
pfam05876 552 Terminase_GpA Phage terminase large subunit (GpA). This 98.86
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Transcript 98.71
COG1444 758 Predicted P-loop ATPase fused to an acetyltransferase [ 98.62
smart00487201 DEXDc DEAD-like helicases superfamily. 98.58
PRK10875 607 recD exonuclease V subunit alpha; Provisional 98.45
PRK13766 764 Hef nuclease; Provisional 98.44
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 98.41
pfam04851103 ResIII Type III restriction enzyme, res subunit. 98.34
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 98.21
PRK02362 736 ski2-like helicase; Provisional 98.19
PRK01172 674 ski2-like helicase; Provisional 98.18
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recombinati 98.16
PRK00254 717 ski2-like helicase; Provisional 98.08
KOG0354 746 consensus 98.05
PTZ00110602 helicase; Provisional 97.72
COG1204 766 Superfamily II helicase [General function prediction on 97.68
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 97.59
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanisms] 97.46
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 97.39
PRK09112352 DNA polymerase III subunit delta'; Validated 97.3
PRK04914 955 ATP-dependent helicase HepA; Validated 97.3
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 97.28
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 97.28
PRK08058329 DNA polymerase III subunit delta'; Validated 97.25
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 97.25
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 97.25
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 97.24
PRK08769319 DNA polymerase III subunit delta'; Validated 97.21
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 97.19
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 97.11
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 97.09
KOG0390 776 consensus 97.09
PRK00440318 rfc replication factor C small subunit; Reviewed 97.07
PRK06871324 DNA polymerase III subunit delta'; Validated 97.05
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 97.04
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.03
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 97.02
PRK07471363 DNA polymerase III subunit delta'; Validated 96.95
COG1875436 NYN ribonuclease and ATPase of PhoH family domains [Gen 96.94
PRK06090319 DNA polymerase III subunit delta'; Validated 96.92
PRK08181269 transposase; Validated 96.86
PRK13889 992 conjugal transfer relaxase TraA; Provisional 96.78
PRK05564313 DNA polymerase III subunit delta'; Validated 96.73
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 96.64
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 96.62
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 96.61
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 96.44
KOG0338 691 consensus 96.33
KOG0335482 consensus 96.3
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 96.25
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 95.98
KOG0330476 consensus 95.93
PRK06526254 transposase; Provisional 95.86
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 95.82
KOG0949 1330 consensus 95.7
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 95.65
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 95.37
KOG0391 1958 consensus 95.34
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 95.26
KOG0340 442 consensus 95.24
PRK07993334 DNA polymerase III subunit delta'; Validated 95.07
TIGR02768 888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 94.74
CHL00095823 clpC Clp protease ATP binding subunit 94.56
KOG2170344 consensus 94.51
PRK07132303 DNA polymerase III subunit delta'; Validated 94.26
PRK07276290 DNA polymerase III subunit delta'; Validated 94.15
KOG0342 543 consensus 94.08
PRK07940395 DNA polymerase III subunit delta'; Validated 93.98
PHA00149331 DNA encapsidation protein 93.62
KOG0339 731 consensus 93.31
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, predi 92.6
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 92.16
KOG0352 641 consensus 92.16
KOG0328400 consensus 91.11
COG5525 611 Bacteriophage tail assembly protein [General function p 90.92
KOG0781587 consensus 90.2
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 98.21
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.03
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.03
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 98.03
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 97.89
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 97.86
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 97.81
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 97.76
PRK04537 574 ATP-dependent RNA helicase RhlB; Provisional 97.73
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 97.7
PRK11776 459 ATP-dependent RNA helicase DbpA; Provisional 97.65
COG4096 875 HsdR Type I site-specific restriction-modification syst 97.43
COG1484254 DnaC DNA replication protein [DNA replication, recombin 97.18
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 97.17
PRK08074 932 bifunctional ATP-dependent DNA helicase/DNA polymerase 97.14
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 97.12
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 97.12
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polymerase 96.67
COG1205 851 Distinct helicase family with a unique C-terminal domai 96.67
PRK12377248 putative replication protein; Provisional 96.63
COG1199 654 DinG Rad3-related DNA helicases [Transcription / DNA re 96.62
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 96.58
PRK10917 677 ATP-dependent DNA helicase RecG; Provisional 96.5
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 96.13
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.12
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.99
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 95.98
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 95.97
PRK09183258 transposase/IS protein; Provisional 95.91
PRK07952242 DNA replication protein DnaC; Validated 95.72
PRK13833323 conjugal transfer protein TrbB; Provisional 95.71
COG1200 677 RecG RecG-like helicase [DNA replication, recombination 95.33
PRK13894320 conjugal transfer ATPase TrbB; Provisional 94.95
TIGR00643 721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 94.67
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.28
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 93.68
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.51
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intracell 93.37
KOG0334 997 consensus 93.03
pfam02456370 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can in 92.88
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 92.88
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 92.71
PRK00149447 dnaA chromosomal replication initiation protein; Review 92.68
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 92.43
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 92.09
PRK06696227 uridine kinase; Validated 92.01
PRK10865857 protein disaggregation chaperone; Provisional 91.53
PRK09270230 frcK putative fructose transport system kinase; Reviewe 91.03
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, reco 90.53
KOG0947 1248 consensus 90.34
KOG0332477 consensus 90.26
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 90.2
PRK10536262 hypothetical protein; Provisional 98.2
PRK05917290 DNA polymerase III subunit delta'; Validated 94.14
PRK10590 457 ATP-dependent RNA helicase RhlE; Provisional 97.98
KOG2036 1011 consensus 97.9
KOG0952 1230 consensus 96.55
TIGR02621 975 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-sub 95.8
KOG0333 673 consensus 95.67
KOG0350 620 consensus 94.73
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 97.71
TIGR00345330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 96.24
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 95.98
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 95.16
pfam00580 494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 93.92
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.59
smart00382148 AAA ATPases associated with a variety of cellular activ 92.73
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 92.63
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 92.59
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 92.51
PRK08116262 hypothetical protein; Validated 92.26
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 92.07
cd01128249 rho_factor Transcription termination factor rho is a ba 91.91
PRK11054 684 helD DNA helicase IV; Provisional 91.59
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta. 90.83
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 90.54
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 90.4
PRK13709 1756 conjugal transfer nickase/helicase TraI; Provisional 97.55
COG5410305 Uncharacterized protein conserved in bacteria [Function 90.83
pfam00176295 SNF2_N SNF2 family N-terminal domain. This domain is fo 97.26
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 97.07
pfam05970 418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 96.95
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.94
pfam05127160 DUF699 Putative ATPase (DUF699). This putative domain i 96.73
KOG1805 1100 consensus 96.68
PRK08699325 DNA polymerase III subunit delta'; Validated 96.33
COG3972 660 Superfamily I DNA and RNA helicases [General function p 96.29
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 94.63
PRK13342 417 recombination factor protein RarA; Reviewed 94.62
KOG0389 941 consensus 94.43
pfam05894333 Podovirus_Gp16 Podovirus DNA encapsidation protein (Gp1 94.21
KOG1015 1567 consensus 93.73
PRK10416499 cell division protein FtsY; Provisional 93.28
PRK05707328 DNA polymerase III subunit delta'; Validated 97.1
PRK12402337 replication factor C small subunit 2; Reviewed 96.49
PRK07399314 DNA polymerase III subunit delta'; Validated 94.69
PRK06964342 DNA polymerase III subunit delta'; Validated 94.44
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 96.85
TIGR00631 667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 93.72
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 96.5
PRK13767 878 ATP-dependent helicase; Provisional 96.03
COG4889 1518 Predicted helicase [General function prediction only] 94.34
PRK06835330 DNA replication protein DnaC; Validated 92.25
TIGR01074 677 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 92.7
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 92.48
PRK04195403 replication factor C large subunit; Provisional 91.11
>pfam03237 Terminase_6 Terminase-like family Back     alignment and domain information
>pfam04466 Terminase_3 Phage terminase large subunit Back     alignment and domain information
>COG5323 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1783 XtmB Phage terminase large subunit [General function prediction only] Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family; InterPro: IPR006437 This group of sequences represent a highly divergent family of the large subunit of phage terminase Back     alignment and domain information
>COG4373 Mu-like prophage FluMu protein gp28 [General function prediction only] Back     alignment and domain information
>pfam03354 Terminase_1 Phage Terminase Back     alignment and domain information
>KOG0331 consensus Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>pfam05876 Terminase_GpA Phage terminase large subunit (GpA) Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345 These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO Back     alignment and domain information
>pfam04851 ResIII Type III restriction enzyme, res subunit Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344 This family describes the exodeoxyribonuclease V alpha subunit, RecD Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0354 consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06674 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07270 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0390 consensus Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763 This entry represents the well-conserved first N-terminal domain of DnaX, approx Back     alignment and domain information
>KOG0338 consensus Back     alignment and domain information
>KOG0335 consensus Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0330 consensus Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK08853 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0949 consensus Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08770 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0391 consensus Back     alignment and domain information
>PRK05648 DNA polymerase III subunits gamma and tau; Reviewed Back     alignment and domain information
>KOG0340 consensus Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136 This entry represents the Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG2170 consensus Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA00149 DNA encapsidation protein Back     alignment and domain information
>KOG0339 consensus Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0352 consensus Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>COG5525 Bacteriophage tail assembly protein [General function prediction only] Back     alignment and domain information
>KOG0781 consensus Back     alignment and domain information
>pfam02562 PhoH PhoH-like protein Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>pfam00270 DEAD DEAD/DEAH box helicase Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB; InterPro: IPR014149 This entry represents TrbB, a protein, which is encoded in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>pfam01695 IstB IstB-like ATP binding protein Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG; InterPro: IPR004609 The ATP-dependent DNA helicase RecG 3 Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0334 consensus Back     alignment and domain information
>pfam02456 Adeno_IVa2 Adenovirus IVa2 protein Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK09270 frcK putative fructose transport system kinase; Reviewed Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947 consensus Back     alignment and domain information
>KOG0332 consensus Back     alignment and domain information
>pfam03308 ArgK ArgK protein Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG2036 consensus Back     alignment and domain information
>KOG0952 consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype; InterPro: IPR013444 This entry represents a CRISPR-associated putative DEAH-box helicase, or Cas3, subtype found in Actinomyces naeslundii MG1, Geobacter sulfurreducens PCA, Gemmata obscuriglobus UQM 2246, and Desulfotalea psychrophila Back     alignment and domain information
>KOG0333 consensus Back     alignment and domain information
>KOG0350 consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00345 arsA arsenite-activated ATPase (arsA); InterPro: IPR003348 This ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IPR013364 Proteins in this entry are predicted ATPases associated with plasmid transfer loci in bacteria Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>pfam00580 UvrD-helicase UvrD/REP helicase Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>pfam02374 ArsA_ATPase Anion-transporting ATPase Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>COG5410 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam00176 SNF2_N SNF2 family N-terminal domain Back     alignment and domain information
>pfam07652 Flavi_DEAD Flavivirus DEAD domain Back     alignment and domain information
>pfam05970 DUF889 PIF1 helicase Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>pfam05127 DUF699 Putative ATPase (DUF699) Back     alignment and domain information
>KOG1805 consensus Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0389 consensus Back     alignment and domain information
>pfam05894 Podovirus_Gp16 Podovirus DNA encapsidation protein (Gp16) Back     alignment and domain information
>KOG1015 consensus Back     alignment and domain information
>PRK10416 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01054 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 All proteins in this family for which functions are known are DNA helicases that function in the nucleotide excision repair and are endonucleases that make the 3' incision next to DNA damage Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 RepA hexameric DNA helicase contain ATP-binding domains similar to those seen in monomeric helicases but which are arranged in a ring Back     alignment and domain information
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321 These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway) Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target367 putative phage terminase, large subunit [Candidatus Lib
3ezk_A 577 Bacteriophage T4 Gp17 Motor Assembly Based On Cryst 2e-21
3cpe_A 592 Crystal Structure Of T4 Gp17 Length = 592 1e-19
2o0h_A385 T4 Gp17 Atpase Domain Mutant Complexed With Atp Len 3e-14
>gi|220702483|pdb|3EZK|A Chain A, Bacteriophage T4 Gp17 Motor Assembly Based On Crystal Structures And Cryo-Em Reconstructions Length = 577 Back     alignment and structure
 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/363 (11%), Positives = 94/363 (25%), Gaps = 63/363 (17%)

Query: 1   MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME 60
           + R     Q   + + E     +C      F   +         +        +Q + ++
Sbjct: 93  LKRANIKTQWTREMVEEWK---KCRDDIVYFAETYCAITHIDYGVIKVQ-LRDYQRDMLK 148

Query: 61  AVDVHCHSNVNNSNPTIFKCAISA-GRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQ 119
            +                +  +    R +GKTT+ A  +   +      ++  +A+  + 
Sbjct: 149 IMS-------------SKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSM 195

Query: 120 LKNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEE 179
               L     + + +LP                   E  + S+ +D+             
Sbjct: 196 SAEVL-DRTKQAIELLPD-----------FLQPGIVEWNKGSIELDNGSSI-------GA 236

Query: 180 RPDTFVGPHNTHGMAVFNDEASGTPD--IINKSILGFFTELNPNRFWIMTSNTRRLNGWF 237
              +           ++ DE +  P+      +I    +    ++  I+ + T      F
Sbjct: 237 YASSPDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSK--IIITTTPNGLNHF 294

Query: 238 YDIFNIPLED----------WKRYQID-TRTVEGIDSGFHEGIISRYGLDSDVARIEILG 286
           YDI+   +E           W   +       +  D G+   I +  G      R E   
Sbjct: 295 YDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTA 354

Query: 287 QFPQQEVNNFIPHNYI----------EEAMSREAIDDLYAPLIMGCDIA-GEGGDKTVVV 335
            F                        +    +    +     I   D + G G D   + 
Sbjct: 355 AFEGTSGTLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALH 414

Query: 336 FRR 338
              
Sbjct: 415 IID 417


>gi|220702377|pdb|3CPE|A Chain A, Crystal Structure Of T4 Gp17 Length = 592 Back     alignment and structure
>gi|145579924|pdb|2O0H|A Chain A, T4 Gp17 Atpase Domain Mutant Complexed With Atp Length = 385 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target367 putative phage terminase, large subunit [Candidatus Lib
3cpe_A 592 Terminase, DNA packaging protein GP17; large terminase, 5e-05
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Length = 592 Back     alignment and structure
 Score = 44.0 bits (103), Expect = 5e-05
 Identities = 22/170 (12%), Positives = 51/170 (30%), Gaps = 19/170 (11%)

Query: 82  ISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQLKNTLWAEVSKWLSMLPHRHWF 141
            +  R +GKTT+ A  +   +      ++  +A+  +     L     +           
Sbjct: 183 CNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMSAEVLD----RTKQA--IELLP 236

Query: 142 EMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEERPDTFVGPHNTHGMAVFNDEAS 201
           +     +      +  L+    I                PD   G        ++ ++ +
Sbjct: 237 DFLQPGIVEWNKGSIELDNGSSIG----------AYASSPDAVRGNSFAM---IYIEDCA 283

Query: 202 GTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDIFNIPLEDWKRY 251
             P+  +  +       +  R  I+ + T      FYDI+   +E    +
Sbjct: 284 FIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLNHFYDIWTAAVEGKSGF 333


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target367 putative phage terminase, large subunit [Candidatus Lib
3cpe_A 592 Terminase, DNA packaging protein GP17; large terminase, 100.0
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide-bindi 99.98
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF 98.83
3h1t_A 590 Type I site-specific restriction-modification system, R 98.82
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA damage 98.58
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP-depen 98.54
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and beta pr 98.32
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATPase, 98.25
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, tran 98.22
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA bindi 98.06
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA complex, 98.0
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombination 98.0
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction 97.64
1z3i_X 644 Similar to RAD54-like; recombination ATPase helicase, r 97.57
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPase, d 97.25
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2.20A 97.24
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, SF2 AT 96.67
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, complex 96.59
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; hydr 96.11
2chq_A319 Replication factor C small subunit; DNA-binding protein 95.69
2chg_A226 Replication factor C small subunit; DNA-binding protein 95.54
2gno_A305 DNA polymerase III, gamma subunit-related protein; TM07 94.16
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA repli 98.59
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, 98.38
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, s 98.3
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winged-hel 98.28
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP 98.22
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fold, A 98.18
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helicase, 98.09
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA 98.08
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, s 98.07
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase DEAD 98.03
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-binding 98.01
3b6e_A216 Interferon-induced helicase C domain-containing protein 98.01
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene 98.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomi 97.87
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus toko 97.84
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, struct 97.83
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, phos 97.81
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-like, 97.76
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA complex, 97.75
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, atom 97.73
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, nucle 97.64
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural geno 97.62
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helic 97.54
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA repair 97.53
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fold, PR 97.52
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, struct 97.51
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, structura 97.5
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, RNA b 97.48
3bor_A237 Human initiation factor 4A-II; translation initiation, 97.43
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A {Geob 97.43
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, nucle 97.4
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box prote 97.39
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-binding, 97.39
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, structu 97.35
2kbe_A226 ATP-dependent RNA helicase DBP5; DBP5P, ATP-binding, cy 97.29
2wjy_A 800 Regulator of nonsense transcripts 1; alternative splici 97.28
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, AT 97.27
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 3.24 97.17
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-box pr 97.09
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged helix 96.99
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-beta fol 96.48
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealing, mi 96.37
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicase, NM 96.17
2z4s_A440 Chromosomal replication initiator protein DNAA; AAA+ AT 94.44
2qgz_A