254781189

254781189

hypothetical protein CLIBASIA_05480

GeneID in NCBI database:8210214Locus tag:CLIBASIA_05480
Protein GI in NCBI database:254781189Protein Accession:YP_003065602.1
Gene range:-(1188579, 1189337)Protein Length:252aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MKKASMRNGILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRYEVIYNFGGPMYGVIVPDFIHDLLDIPEEKRRLNTSYLTYVDRGLLDVRSSETPVVYDNKYRPSAEAMRTICPTKLMKIFEDTISLYVDPLTPRDISFTQYEKHACALVNWLEKGKFNEMSIARKAFNRRSQR
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHEEcHHHHHHHHHccHHHHHccHHHHHHHHHHHHHcccccccEEEcccccccHHHHHHHcHHHHHHHHHHHHHHEEcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccc
cccccHHcHHHHHHHHHHHHHHHHHHHHHHHHccHcEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccHHHHHHHHHHcHcccHHHHHHHHHHHHHHHHccccEEEEEEccccccEEEcccHHHHHccccHHHHcccccEEEEEcccccccccccccEEEcccccccHHHHHHHcHHHHHHHHHHcEEEEEccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccc
mkkasmrnGILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRYEVIYNfggpmygvivpdfihdlldipeekrrlnTSYLTYVDRglldvrssetpvvydnkyrpsaeamRTICPTKLMKIFEDTIslyvdpltprdisfTQYEKHACALVNWLEKGKFNEMSIARKAFNRRSQR
mkkasmrngilSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKikedsaserLVKATEACACLTQYDRYEVIYNFGGPMYGVIVPDFIHDLLDIPEEKRRLNTSYLtyvdrglldvrssetpvvydnkyrpsaeaMRTICPTKLMKIFEDTISLYVDPLTPRDISFTQYEKHACALVNWlekgkfnemsIARKAFNRRSQR
MKKASMRNGILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRYEVIYNFGGPMYGVIVPDFIHDLLDIPEEKRRLNTSYLTYVDRGLLDVRSSETPVVYDNKYRPSAEAMRTICPTKLMKIFEDTISLYVDPLTPRDISFTQYEKHACALVNWLEKGKFNEMSIARKAFNRRSQR
**********LSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEECLRLNDIKYEEEQAI************LVKATEACACLTQYDRYEVIYNFGGPMYGVIVPDFIHDLLDIPEEKRRLNTSYLTYVDRGLLDVRSSETPVVYDNKYRPSAEAMRTICPTKLMKIFEDTISLYVDPLTPRDISFTQYEKHACALVNWLEKGKFNEMSIA***F******
MKKASMRNGILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRYEVIYNFGGPMYGVIVPDFIHDLLDIPEEKRRLNTSYLTYVDRGLLDVRSSETPVVYDNKYRPSAEAMRTICPTKLMKIFEDTISLYVDPLTPRDISFTQYEKHACALVNWLEKGKFNEMSIARKAFNRRSQR
******RNGILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRYEVIYNFGGPMYGVIVPDFIHDLLDIPEEKRRLNTSYLTYVDRGLLDVRSSETPVVYDNKYRPSAEAMRTICPTKLMKIFEDTISLYVDPLTPRDISFTQYEKHACALVNWLEKGKFNEMSIARKAFNR****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKASMRNGILSIKRILKAILSRWRKSKLSALGSVGVFFVIFSLPLGALGLYEVHYLWVIFVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRYEVIYNFGGPMYGVIVPDFIHDLLDIPEEKRRLNTSYLTYVDRGLLDVRSSETPVVYDNKYRPSAEAMRTICPTKLMKIFEDTISLYVDPLTPRDISFTQYEKHACALVNWLEKGKFNEMSIARKAFNRRSQR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target252 hypothetical protein CLIBASIA_05480 [Candidatus Liberib
254780204180 hypothetical protein CLIBASIA_00445 [Candidatus Li 7e-07
25478020382 hypothetical protein CLIBASIA_00440 [Candidatus Li 2e-06
25478112559 hypothetical protein CLIBASIA_05135 [Candidatus Li 0.011
>gi|254780204|ref|YP_003064617.1| hypothetical protein CLIBASIA_00445 [Candidatus Liberibacter asiaticus str. psy62] Length = 180 Back     alignment
 Score = 45.8 bits (107), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 65  LSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQYDRY 120
           LS+AI    +EE + +NDIKYE +Q I  K KE    E L + +E  ACL   +RY
Sbjct: 101 LSIAIPT--IEEGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEHPNRY 154

>gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] Length = 82 Back     alignment
 Score = 44.3 bits (103), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 6/80 (7%)

Query: 177 DNKYRPSAEAMRTICPTKLMKIFEDTISLY-----VDPLTPRDISFTQYEKHACALVNWL 231
           D KYRPS E +R   P +L+K  E  +S +      +P+      +  Y  H C L+  L
Sbjct: 3   DRKYRPSKEEVRDAFP-ELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELL 61

Query: 232 EKGKFNEMSIARKAFNRRSQ 251
           +   F+ + I RK++N R  
Sbjct: 62  KNKDFDGVEIERKSYNLRKN 81

>gi|254781125|ref|YP_003065538.1| hypothetical protein CLIBASIA_05135 [Candidatus Liberibacter asiaticus str. psy62] Length = 59 Back     alignment
 Score = 32.0 bits (71), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 109 EACACLTQYDRYEVIYNFGGPMYGVI----VPDFIHDLLDIPEEKRRL 152
           E   CL   +RY +  +   P Y VI    VP FI++ L+IP +KR++
Sbjct: 6   EYIRCLNDPNRYRL--SAKDPHYNVIFRDEVPSFIYETLNIPADKRKM 51

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target252 hypothetical protein CLIBASIA_05480 [Candidatus Liberib
254780204180 hypothetical protein CLIBASIA_00445 [Candidatus Liberib 2 0.002
>gi|254780204|ref|YP_003064617.1| hypothetical protein CLIBASIA_00445 [Candidatus Liberibacter asiaticus str. psy62] Length = 180 Back     alignment and organism information
 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 36/64 (56%)

Query: 57  LWVIFVSSLSLAIVAFGVEECLRLNDIKYEEEQAIQLKIKEDSASERLVKATEACACLTQ 116
           L V  + ++ L+I    +EE + +NDIKYE +Q I  K KE    E L + +E  ACL  
Sbjct: 91  LVVTAILAILLSIAIPTIEEGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEH 150

Query: 117 YDRY 120
            +RY
Sbjct: 151 PNRY 154


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target252 hypothetical protein CLIBASIA_05480 [Candidatus Liberib
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 3e-04
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 40.8 bits (94), Expect = 3e-04
 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 6/28 (21%)

Query: 87  EEQAIQ-----LKI-KEDSASERLVKAT 108
           E+QA++     LK+  +DSA    +KAT
Sbjct: 18  EKQALKKLQASLKLYADDSAPALAIKAT 45


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00