254781190

254781190

hypothetical protein CLIBASIA_05485

GeneID in NCBI database:8210215Locus tag:CLIBASIA_05485
Protein GI in NCBI database:254781190Protein Accession:YP_003065603.1
Gene range:-(1189297, 1189998)Protein Length:233aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:DR0530-like primase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD
cccccccccEEcccEEEcccccccEEEEEcccccHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccHHHHHccccccccEEEEEcccEEEEccccccccccEEEcccHHHccHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHccccc
cccccccccccccEEEEEcccccccEEEEcccccHHHHHHHHHHHHHHcccccEEccccccEEEEEEEccccccccccccccccEEEEEEcccEEEEEEEccccccccccccccccccHHHcccccHHHHHHHHHHHHHHccccccccHEEccccEccccccccEEEHHHHHHHHHHHHHHccccHHHHHHHHHEEEEEccccccccEEEHHHccccccccHHHHHHHHHccc
MVATDVDHYVYNGFgilcgigthpvyafdvdvldeQVVDRFNNEfqsccgkpisrvgqapKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVaynihpktqraytwsiaphalkveelplltpdeVEYFFEFFdtittprdkeKSYRKLSKIWKshnnrrytNIEIRAFLSCFgeefyngshdewIPVVMAIHYETRGSAEGKEIVREWCKlgrtydeksfnakwdsfd
MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEfqsccgkpisrvgqAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFfdtittprdkeksyRKLSkiwkshnnrrytNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETrgsaegkeIVREWCKlgrtydeksfnakwdsfd
MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD
****DVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNL********IQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFD***************************TNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCK********SFNAKWDSF*
MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD
MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD
MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD
MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target233 hypothetical protein CLIBASIA_05485 [Candidatus Liberib
254781225 789 P4 family phage/plasmid primase [Candidatus Liberi 3e-81
>gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] Length = 789 Back     alignment
 Score =  292 bits (748), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 132/233 (56%), Positives = 169/233 (72%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP 60
           + +  +D     GFG +CG+G  P+YAFD+D  DE+  + F + F+   G PI R+GQ P
Sbjct: 41  LSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKP 100

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
           K L+ FRM +  +KK+K+ E  QGHL+ L  GQ FVAYNIHPKT++ YTW+  PH  KVE
Sbjct: 101 KILIPFRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVE 160

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
           + PLL+ ++VEY F+FF  IT P  K+K     SK W ++NNR+YTN EI AFLSCFGEE
Sbjct: 161 DTPLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEE 220

Query: 181 FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
           FYNGSHDEWIPVVMA+H+ETRGS++GKEI R W K G TYDE++FN KWD+FD
Sbjct: 221 FYNGSHDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFD 273

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target233 hypothetical protein CLIBASIA_05485 [Candidatus Liberib
254781225 789 P4 family phage/plasmid primase [Candidatus Liberibacte 1 2e-77
317120690 790 phage associated primase [Liberibacter phage SC1] Lengt 1 3e-77
317120732 790 phage associated primase/P4 family phage/plasmid primas 1 2e-66
315121955 686 P4 family phage/plasmid primase [Candidatus Liberibacte 1 2e-51
315122923 356 P4 family phage/plasmid primase [Candidatus Liberibacte 1 3e-51
41179390 854 Bbp29 [Bordetella phage BPP-1] Length = 854 1 7e-23
91214217 843 DR0530-like primase [Burkholderia phage BcepNazgul] Len 1 9e-16
254463719 890 Primase C terminal 2 family [Rhodobacterales bacterium 1 2e-15
269975282 554 primase [Staphylococcus phage SA1] Length = 554 1 2e-14
150396564 793 hypothetical protein Smed_1346 [Sinorhizobium medicae W 1 1e-12
>gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] Length = 789 Back     alignment and organism information
 Score =  292 bits (748), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 132/233 (56%), Positives = 169/233 (72%)

Query: 1   MVATDVDHYVYNGFGILCGIGTHPVYAFDVDVLDEQVVDRFNNEFQSCCGKPISRVGQAP 60
           + +  +D     GFG +CG+G  P+YAFD+D  DE+  + F + F+   G PI R+GQ P
Sbjct: 41  LSSEKIDKLPACGFGFVCGVGEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKP 100

Query: 61  KTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120
           K L+ FRM +  +KK+K+ E  QGHL+ L  GQ FVAYNIHPKT++ YTW+  PH  KVE
Sbjct: 101 KILIPFRMNKEGIKKKKTTESTQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVE 160

Query: 121 ELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEE 180
           + PLL+ ++VEY F+FF  IT P  K+K     SK W ++NNR+YTN EI AFLSCFGEE
Sbjct: 161 DTPLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEE 220

Query: 181 FYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233
           FYNGSHDEWIPVVMA+H+ETRGS++GKEI R W K G TYDE++FN KWD+FD
Sbjct: 221 FYNGSHDEWIPVVMAVHHETRGSSKGKEIARRWSKQGSTYDEENFNYKWDTFD 273


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|317120690|gb|ADV02513.1| phage associated primase [Liberibacter phage SC1] Length = 790 Back     alignment and organism information
>gi|317120732|gb|ADV02554.1| phage associated primase/P4 family phage/plasmid primase [Liberibacter phage SC2] Length = 790 Back     alignment and organism information
>gi|315121955|ref|YP_004062444.1| P4 family phage/plasmid primase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 686 Back     alignment and organism information
>gi|315122923|ref|YP_004063412.1| P4 family phage/plasmid primase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 356 Back     alignment and organism information
>gi|41179390|ref|NP_958698.1| Bbp29 [Bordetella phage BPP-1] Length = 854 Back     alignment and organism information
>gi|91214217|ref|NP_919008.2| DR0530-like primase [Burkholderia phage BcepNazgul] Length = 843 Back     alignment and organism information
>gi|254463719|ref|ZP_05077130.1| Primase C terminal 2 family [Rhodobacterales bacterium Y4I] Length = 890 Back     alignment and organism information
>gi|269975282|gb|ACZ55506.1| primase [Staphylococcus phage SA1] Length = 554 Back     alignment and organism information
>gi|150396564|ref|YP_001327031.1| hypothetical protein Smed_1346 [Sinorhizobium medicae WSM419] Length = 793 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target233 hypothetical protein CLIBASIA_05485 [Candidatus Liberib
pfam0870774 pfam08707, PriCT_2, Primase C terminal 2 (PriCT-2) 1e-04
>gnl|CDD|149686 pfam08707, PriCT_2, Primase C terminal 2 (PriCT-2) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 233 hypothetical protein CLIBASIA_05485 [Candidatus Liberib
cd04859152 Prim_Pol Prim_Pol: Primase-polymerase (primpol) domain 99.85
pfam09250161 Prim-Pol Bifunctional DNA primase/polymerase, N-termina 99.78
cd00525136 AE_Prim_S_like AE_Prim_S_like: primase domain similar t 99.09
pfam0870774 PriCT_2 Primase C terminal 2 (PriCT-2). This alpha heli 99.7
pfam08800136 VirE_N VirE N-terminal domain. This presumed domain is 90.01
>cd04859 Prim_Pol Prim_Pol: Primase-polymerase (primpol) domain of the type found in bifunctional replicases from archaeal plasmids, including ORF904 protein of the crenarchaeal plasmid pRN1 from Sulfolobus islandicus (pRN1 primpol) Back     alignment and domain information
>pfam09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal Back     alignment and domain information
>cd00525 AE_Prim_S_like AE_Prim_S_like: primase domain similar to that found in the small subunit of archaeal and eukaryotic (A/E) DNA primases Back     alignment and domain information
>pfam08707 PriCT_2 Primase C terminal 2 (PriCT-2) Back     alignment and domain information
>pfam08800 VirE_N VirE N-terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target233 hypothetical protein CLIBASIA_05485 [Candidatus Liberib
1ro2_A216 Hypothetical protein ORF904; DNA polymerase, primase, r 99.68
3m1m_A335 ORF904; primase, polymerase, plasmid, replication; 1.85 99.56
3h20_A323 Replication protein B; primase, nucleotidyltransferase, 96.22
>1ro2_A Hypothetical protein ORF904; DNA polymerase, primase, replication, polymerization, evolution of nucleic acid polymerizing enzymes; 1.60A {Sulfolobus islandicus} SCOP: d.264.1.2 PDB: 1ro0_A 1rni_A Back     alignment and structure
Probab=99.68  E-value=1.5e-17  Score=119.01  Aligned_cols=105  Identities=9%  Similarity=0.080  Sum_probs=68.7

Q ss_pred             HHHHHCCCCC-CEEEEECCCCCCEEEEEEECCCHHHHHHH---HHHHHHHCCCCEEEECCCCCEEEEEECCCCCCCCCCC
Q ss_conf             3787518616-88997078848889999548984678999---9977640898629867889539998447431243357
Q gi|254781190|r    3 ATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRF---NNEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKS   78 (233)
Q Consensus         3 a~~~~~~p~~-giGi~~G~~s~~l~~iDiD~~d~~~~~~~---~~~~~~~~~~~~~~~g~~~~~~~lfr~~~~~~~~~~~   78 (233)
                      ..+++++|.+ ||||+||+ + ++++||||..  .....+   ..+.+.+..+++++++ .++.|+||+.++.+..+...
T Consensus        47 ~~w~~~~p~~~NiGI~tG~-s-glvViDiD~~--~~~~~~~~~~~l~~~~~~T~~v~Tp-sGG~HlYf~~~~~p~~~~~~  121 (216)
T 1ro2_A           47 QRFLKMIEEGYNYAIPGGQ-K-GMVIMDFESK--EKLKAWIGESALEELCRKTLCTNTV-HGGIHIYVLSNDIPPHKINP  121 (216)
T ss_dssp             HHHHHHHHHTCEEEEESSG-G-GEEEEEESCH--HHHHHHHCHHHHHHHHHHSCEEECT-TSCEEEEEECSCCCSSCCCC
T ss_pred             HHHHHHCCCCCEEEEECCC-C-CEEEEECCCC--CHHHHHHHHHHHHHCCCCCEEEECC-CCEEEEEEECCCCCCCCCCC
T ss_conf             9999859975559998178-8-8899978885--2066665556666208886699889-98589999778878554365


Q ss_pred             C--CCCCCCEEEEECCCEEEECCC-----C-CCCCCCEEEEC
Q ss_conf             7--767663589845832895366-----8-88888457421
Q gi|254781190|r   79 E--EKIQGHLEFLAYGQQFVAYNI-----H-PKTQRAYTWSI  112 (233)
Q Consensus        79 ~--~~~~~~iEi~~~g~q~V~~g~-----h-p~Tg~~Y~W~~  112 (233)
                      .  ......||||+.|+|||+|||     | +.++.+|+|.+
T Consensus       122 ~~~~~g~~~iDir~~ggYVVaPgS~i~h~~~~~~~~~~~~~~  163 (216)
T 1ro2_A          122 LFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQN  163 (216)
T ss_dssp             SEESSSSEEEEEECTTCEEECTTCEEEGGGCCSTTCTTTTCS
T ss_pred             CEECCCCCEEEEEECCCEEEECCEECCCCCCCCCCCCCCCCC
T ss_conf             332389844899716988995581035666787777745787



>3m1m_A ORF904; primase, polymerase, plasmid, replication; 1.85A {Sulfolobus islandicus} Back     alignment and structure
>3h20_A Replication protein B; primase, nucleotidyltransferase, helix-bundle-domain; 1.99A {Plasmid RSF1010} PDB: 3h25_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target233 hypothetical protein CLIBASIA_05485 [Candidatus Liberib
d1ro0a_210 Bifunctional DNA primase/polymerase N-terminal domain { 99.7
>d1ro0a_ d.264.1.2 (A:) Bifunctional DNA primase/polymerase N-terminal domain {Archaeon Sulfolobus islandicus [TaxId: 43080]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Prim-pol domain
superfamily: Prim-pol domain
family: Bifunctional DNA primase/polymerase N-terminal domain
domain: Bifunctional DNA primase/polymerase N-terminal domain
species: Archaeon Sulfolobus islandicus [TaxId: 43080]
Probab=99.70  E-value=4.4e-18  Score=120.68  Aligned_cols=105  Identities=10%  Similarity=0.066  Sum_probs=69.8

Q ss_pred             HHHHHCCCCC-CEEEEECCCCCCEEEEEEECCCHHHHHHHH---HHHHHHCCCCEEEECCCCCEEEEEECCCCCCCCCCC
Q ss_conf             3787518616-889970788488899995489846789999---977640898629867889539998447431243357
Q gi|254781190|r    3 ATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFN---NEFQSCCGKPISRVGQAPKTLMLFRMQETNLKKQKS   78 (233)
Q Consensus         3 a~~~~~~p~~-giGi~~G~~s~~l~~iDiD~~d~~~~~~~~---~~~~~~~~~~~~~~g~~~~~~~lfr~~~~~~~~~~~   78 (233)
                      ..+++++|.+ ||||+||. + |+++||||..  .....+.   .+...+..+.+++++ .+++|+||+.++.+..+...
T Consensus        47 ~~w~~~~p~~~NiGi~~G~-s-glVViDiD~~--~~~~~~~~~~~l~~~~~~T~~v~Tp-sGG~HlYf~~~e~p~~~~~~  121 (210)
T d1ro0a_          47 QRFLKMIEEGYNYAIPGGQ-K-GMVIMDFESK--EKLKAWIGESALEELCRKTLCTNTV-HGGIHIYVLSNDIPPHKINP  121 (210)
T ss_dssp             HHHHHHHHTTCEEEEESSG-G-GEEEEEESCH--HHHHHHHCHHHHHHHHHHSCEEECT-TSCEEEEEECSSCCSSCCCC
T ss_pred             HHHHHHCCCCCEEEEECCC-C-CEEEEECCCC--HHHHHHHHHHHHHCCCCCCEEEECC-CCCEEEEEECCCCCCCCCCC
T ss_conf             9998749875548996377-7-7899987882--3455541004554348887599879-99189999878877542134


Q ss_pred             C--CCCCCCEEEEECCCEEEECCC-----CCCC-CCCEEEEC
Q ss_conf             7--767663589845832895366-----8888-88457421
Q gi|254781190|r   79 E--EKIQGHLEFLAYGQQFVAYNI-----HPKT-QRAYTWSI  112 (233)
Q Consensus        79 ~--~~~~~~iEi~~~g~q~V~~g~-----hp~T-g~~Y~W~~  112 (233)
                      .  ......|||++.|+|||+|||     |++| +.+|+|.+
T Consensus       122 ~~~~~g~~~iDir~~g~yVv~PpS~~~h~h~~~~~~~~~~~~  163 (210)
T d1ro0a_         122 LFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQN  163 (210)
T ss_dssp             SEEETTEEEEEEECTTCEEECTTCEEEGGGCCSTTCTTTTCS
T ss_pred             CEECCCCCEEEEEEECCEEEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             466178735889700898995574246635677777641555



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target233 hypothetical protein CLIBASIA_05485 [Candidatus Liberib
1ro2_A_216 Hypothetical protein ORF904; DNA polymerase, prima 99.78
>1ro2_A (A:) Hypothetical protein ORF904; DNA polymerase, primase, replication, polymerization, evolution of nucleic acid polymerizing enzymes; 1.60A {Sulfolobus islandicus} Back     alignment and structure
Probab=99.78  E-value=9.5e-20  Score=132.51  Aligned_cols=135  Identities=11%  Similarity=0.132  Sum_probs=89.9

Q ss_pred             CHHHHHCCCCC-CEEEEECCCCCCEEEEEEECCCHHHHHHHHHH---HHHHCCCCEEEECCCCCEEEEEECCCCCCCCCC
Q ss_conf             23787518616-88997078848889999548984678999997---764089862986788953999844743124335
Q gi|254781190|r    2 VATDVDHYVYN-GFGILCGIGTHPVYAFDVDVLDEQVVDRFNNE---FQSCCGKPISRVGQAPKTLMLFRMQETNLKKQK   77 (233)
Q Consensus         2 va~~~~~~p~~-giGi~~G~~s~~l~~iDiD~~d~~~~~~~~~~---~~~~~~~~~~~~g~~~~~~~lfr~~~~~~~~~~   77 (233)
                      |..++..+|.+ ||||.||.  .++++||+|.  ......+..+   ...+..++.++++ ++++|+|||+|+....+..
T Consensus        46 i~~w~~~~p~~~nigi~~G~--~~~vviD~D~--~~g~~~~~~l~~~~~~l~~t~~~~T~-~gG~h~~f~~p~~~~~~~~  120 (216)
T 1ro2_A           46 KQRFLKMIEEGYNYAIPGGQ--KGMVIMDFES--KEKLKAWIGESALEELCRKTLCTNTV-HGGIHIYVLSNDIPPHKIN  120 (216)
T ss_dssp             HHHHHHHHHHTCEEEEESSG--GGEEEEEESC--HHHHHHHHCHHHHHHHHHHSCEEECT-TSCEEEEEECSCCCSSCCC
T ss_pred             HHHHHHHCCCCCEEEEECCC--CCEEEEECCC--CCHHHHHHHHHHHHHCCCCCEEEECC-CCCEEEEEECCCCCCCCCC
T ss_conf             99999849975659996487--7789998888--52034442224566238886489858-9917999976888865315


Q ss_pred             C--CCCCCCCEEEEECCCEEEECCC----CCCCCCCEEEECCCCC---CCHHHCCCCCHHHHHHHHHHHHHHC
Q ss_conf             7--7767663589845832895366----8888884574216776---8822367689999999997544201
Q gi|254781190|r   78 S--EEKIQGHLEFLAYGQQFVAYNI----HPKTQRAYTWSIAPHA---LKVEELPLLTPDEVEYFFEFFDTIT  141 (233)
Q Consensus        78 ~--~~~~~~~iEi~~~g~q~V~~g~----hp~Tg~~Y~W~~~~~~---~~~~~lP~~~~~~l~~~~~~~~~~~  141 (233)
                      .  ......+||||+.|+|+|+|||    ||.||+.|+|..++..   .+...++.+....+..+........
T Consensus       121 ~~~~~~~~~gvdir~~g~~vV~ppS~~~~~~~~g~~Y~w~~~~~~~~~~p~~~~~~l~~~~~~~~~~~~~~~~  193 (216)
T 1ro2_A          121 PLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKG  193 (216)
T ss_dssp             CSEESSSSEEEEEECTTCEEECTTCEEEGGGCCSTTCTTTTCSCEEECEESSSCCCCEECCHHHHHHHHHHHH
T ss_pred             CCEECCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             5443278842889836988996361046646787766524566556676743335554255367899999877