254781192

254781192

hypothetical protein CLIBASIA_05495

GeneID in NCBI database:8210217Locus tag:CLIBASIA_05495
Protein GI in NCBI database:254781192Protein Accession:YP_003065605.1
Gene range:+(1190526, 1191122)Protein Length:198aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:conserved hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MAKVLIKGRLSYPQLHEPRAYGDKGDEVYSADILFSKTDNEQCDKLEQAIREAGEEKFGGSNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQGTKGVTFTLTGVQFVKDDTRWGGQLRASSSDFESYEEETASIDELEEMPF
cccEEEEEEEEccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccccccccccccccHHccccEEEcccccccccccccccHHHHHHccccEEEEEEEEEEEEEEEEEEcccccEEEEEEccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccc
cEEEEccEEEcHHHHccccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccccccccccccEEccccccEEEEcccccccccEEccccccccccccccEEEEEEEEEEEEEEEEcccccccEEEccccEEEEcccccccccccccHHcHHcHHHHHHHHHHHccccc
MAKVLikgrlsypqlhepraygdkgdevysaDILFSKTDNEQCDKLEQAIREAgeekfggsnMSALIERMKrtgryplkdgdqkistslkpeayevyagqyyitpknkkvrprlvDRHVQEVTENIQEVFYSGCHVNAIISVYAYTfqgtkgvtftltgvqfvkddtrwggqlrasssdfesyeeetasideleempf
makvlikgrlsypqlhepraygdkgdEVYSADILFSKTDNEQCDKLEQAIReageekfggsnmSALIERMKRtgryplkdgdqkistslkpeayevyagqyyitpknkkvrpRLVDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQGTKGVTFTLTGVQFvkddtrwggqlrasssdfesyeeetasideleempf
MAKVLIKGRLSYPQLHEPRAYGDKGDEVYSADILFSKTDNEQCDKLEQAIREAGEEKFGGSNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQGTKGVTFTLTGVQFVKDDTRWGGQLRASSSDFESYEEETASIDELEEMPF
***VLIKGRLSYPQLHEPRAY****DEVYSADILFSKTDNEQCDKLEQAIREAG**************RMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQGTKGVTFTLTGVQFVKDDTRWGG**R*****FESYEEETASIDELEEMPF
MAKVLIKGRLSYPQLHEPRAYGDKGDEVYSADILFSKTDNEQCDKLEQAIREAGEEKFGGSNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQGTKGVTFTLTGVQFVKDDTRWGGQLRA***************DELEEMPF
MAKVLIKGRLSYPQLHEPRAYGDKGDEVYSADILFSKTDNEQCDKLEQAIREAGEEKFGGSNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQGTKGVTFTLTGVQFVKDD*************FESYEEETASIDELE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKVLIKGRLSYPQLHEPRAYGDKGDEVYSADILFxxxxxxxxxxxxxxxxxxxxxKFGGSNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQGTKGVTFTLTGVQFVKDDTRWGGQLRASSSDFESYEEETASIDELEEMPF
MAKVLIKGRLSYPQLHEPRAYGDKGDEVYSADILFSKTDNEQCDKLEQAIREAGEEKFGGSNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQGTKGVTFTLTGVQFVKDDTRWGGQLRASSSDFESYEEETASIDELEEMPF
MAKVLIKGRLSYPQLHEPRAYGDKGDEVYSADILFSKTDNEQCDKLEQAIREAGEEKFGGSNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQGTKGVTFTLTGVQFVKDDTRWGGQLRASSSDFESYEEETASIDELEEMPF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target198 hypothetical protein CLIBASIA_05495 [Candidatus Liberib
254780126216 hypothetical protein CLIBASIA_00025 [Candidatus Li 1e-33
>gi|254780126|ref|YP_003064539.1| hypothetical protein CLIBASIA_00025 [Candidatus Liberibacter asiaticus str. psy62] Length = 216 Back     alignment
 Score =  134 bits (337), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 113/197 (57%), Gaps = 9/197 (4%)

Query: 1   MAKVLIKGRLSYPQLH-EPRAYGDKGDEV--YSADILFSKTDNEQCDKLEQAIREAGEEK 57
           M K+ +KGRLSYP L  + R     G  V  Y  DI+F K D +Q + +E  ++ A  E 
Sbjct: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60

Query: 58  FGGSNMSALIE--RMKRTGRYPLKDGDQKISTSLKPEAY-EVYAGQYYITPKNKKVRPRL 114
           F   +  A +   R K   R  L+DGD KI++S KPE Y + Y    YI+ KNK V+P L
Sbjct: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120

Query: 115 VDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQG--TKGVTFTLTGVQFVKDDTRWGGQ 172
           VDR  Q V++  +EVFY GC V A +++ AY      TKG + TLTGVQF K D RWG  
Sbjct: 121 VDRQAQPVSDP-REVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179

Query: 173 LRASSSDFESYEEETAS 189
            ++ +S+F+ Y EE  S
Sbjct: 180 PKSDTSEFKDYGEEQDS 196

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target198 hypothetical protein CLIBASIA_05495 [Candidatus Liberib
315121966214 hypothetical protein CKC_01080 [Candidatus Liberibacter 1 3e-32
255957555216 hypothetical protein [Candidatus Liberibacter asiaticus 1 4e-31
255957640216 hypothetical protein [Candidatus Liberibacter asiaticus 1 6e-31
255957560216 hypothetical protein [Candidatus Liberibacter asiaticus 1 1e-30
255957610216 hypothetical protein [Candidatus Liberibacter asiaticus 1 2e-30
254780126216 hypothetical protein CLIBASIA_00025 [Candidatus Liberib 1 7e-30
315122934183 hypothetical protein CKC_05950 [Candidatus Liberibacter 1 2e-29
71276265188 phage-related protein [Xylella fastidiosa Dixon] Length 1 2e-18
212712319183 hypothetical protein PROVALCAL_03407 [Providencia alcal 1 6e-18
256617075182 conserved hypothetical protein [Enterococcus faecalis A 1 3e-17
>gi|315121966|ref|YP_004062455.1| hypothetical protein CKC_01080 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 214 Back     alignment and organism information
 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 116/190 (61%), Gaps = 9/190 (4%)

Query: 1   MAKVLIKGRLSYPQLHE--PRAYGDKG-DEVYSADILFSKTDNEQCDKLEQAIREAGEEK 57
           M  + IKGRLSYP L +      GD    E + ADI+  KT+ E   +  + +R+A ++ 
Sbjct: 1   MQSIKIKGRLSYPALDKMTKMTLGDNSVMEYFGADIIIPKTNKETIARFTEVLRKAAKDS 60

Query: 58  FGGSNMSALIERMKRTGRYPLKDGDQKISTSLKPEAY-EVYAGQYYITPKNKKVRPRLVD 116
           +   N    IE+ +   R  +KDGD+KI+T+ KPE Y + Y   +YI+ KNK V+P LVD
Sbjct: 61  YPNMNPDRFIEQARINKRAIIKDGDEKIATATKPETYTKAYTNSWYISAKNKLVQPLLVD 120

Query: 117 RHVQEVTENIQEVFYSGCHVNAIISVYAY---TFQGTKGVTFTLTGVQFVKDDTRWGGQL 173
           R  Q +  N ++VFY+GC V A +++  Y   TF+ TKG + TLTGVQF K+D RWG   
Sbjct: 121 RQAQ-IVSNPRDVFYAGCWVIAKLNISTYELGTFK-TKGFSCTLTGVQFFKNDERWGASP 178

Query: 174 RASSSDFESY 183
           +A++S+F+ Y
Sbjct: 179 KANASEFDDY 188


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|255957555|dbj|BAH96617.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 216 Back     alignment and organism information
>gi|255957640|dbj|BAH96685.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 216 Back     alignment and organism information
>gi|255957560|dbj|BAH96621.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 216 Back     alignment and organism information
>gi|255957610|dbj|BAH96661.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 216 Back     alignment and organism information
>gi|254780126|ref|YP_003064539.1| hypothetical protein CLIBASIA_00025 [Candidatus Liberibacter asiaticus str. psy62] Length = 216 Back     alignment and organism information
>gi|315122934|ref|YP_004063423.1| hypothetical protein CKC_05950 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 183 Back     alignment and organism information
>gi|71276265|ref|ZP_00652543.1| phage-related protein [Xylella fastidiosa Dixon] Length = 188 Back     alignment and organism information
>gi|212712319|ref|ZP_03320447.1| hypothetical protein PROVALCAL_03407 [Providencia alcalifaciens DSM 30120] Length = 183 Back     alignment and organism information
>gi|256617075|ref|ZP_05473921.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200] Length = 182 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target198 hypothetical protein CLIBASIA_05495 [Candidatus Liberib
pfam10991181 pfam10991, DUF2815, Protein of unknown function (DUF281 2e-28
>gnl|CDD|151438 pfam10991, DUF2815, Protein of unknown function (DUF2815) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 198 hypothetical protein CLIBASIA_05495 [Candidatus Liberib
pfam10991181 DUF2815 Protein of unknown function (DUF2815). This is 100.0
PHA00458230 single-stranded DNA-binding protein 100.0
>pfam10991 DUF2815 Protein of unknown function (DUF2815) Back     alignment and domain information
>PHA00458 single-stranded DNA-binding protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target198 hypothetical protein CLIBASIA_05495 [Candidatus Liberib
1je5_A206 Crystal Structure Of Gp2.5, A Single-Stranded Dna B 8e-17
>gi|15826753|pdb|1JE5|A Chain A, Crystal Structure Of Gp2.5, A Single-Stranded Dna Binding Protein Encoded By Bacteriophage T7 Length = 206 Back     alignment and structure
 Score = 91.0 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 26/184 (14%), Positives = 55/184 (29%), Gaps = 16/184 (8%)

Query: 12  YPQLHEPRAY-----GDKGDEVYSADILFSKTDNEQCDKLEQAIREAGEEKFGGSNMSAL 66
           Y  + +P              VY  D+     D      +++ ++   E           
Sbjct: 16  YAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEA 75

Query: 67  IERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKNKKVR------PRLVDRHVQ 120
                  G+ PLK  +  +      +    +  + Y + ++KK +        +VD   +
Sbjct: 76  NPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGK 135

Query: 121 EVTENIQEVFYSGCHVNAIISVYAY--TFQGTKGVTFTLTGVQFVKDDTRWGGQLRASSS 178
           ++      +   G  +    S+  Y         V   L  V  V+    +GG     + 
Sbjct: 136 KM--EDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELA-TFGGGEDDWAD 192

Query: 179 DFES 182
           + E 
Sbjct: 193 EVEE 196


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target198 hypothetical protein CLIBASIA_05495 [Candidatus Liberib
1je5_A206 Helix-destabilizing protein; OB-fold, beta barrel, DNA 3e-18
>1je5_A Helix-destabilizing protein; OB-fold, beta barrel, DNA binding protein; 1.90A {Enterobacteria phage T7} SCOP: b.40.4.7 Length = 206 Back     alignment and structure
 Score = 87.0 bits (215), Expect = 3e-18
 Identities = 29/207 (14%), Positives = 59/207 (28%), Gaps = 20/207 (9%)

Query: 1   MAKVLIKG----RLSYPQLHEP-----RAYGDKGDEVYSADILFSKTDNE------QCDK 45
           MAK +          Y  + +P              VY  D+     D        +  K
Sbjct: 1   MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVK 60

Query: 46  LEQAIREAGEEKFGGSNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITP 105
             +    A  E++  +  +    +                  +   +     + Q   T 
Sbjct: 61  CHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTK 120

Query: 106 KNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQG--TKGVTFTLTGVQFV 163
           + K +   +VD   +++ +    +   G  +    S+  Y +       V   L  V  V
Sbjct: 121 ETKHINLVVVDSKGKKMED--VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLV 178

Query: 164 KDDTRWGGQLRASSSDFE-SYEEETAS 189
           +  T  GG+   +    E  Y    ++
Sbjct: 179 ELATFGGGEDDWADEVEENGYVASGSA 205


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target198 hypothetical protein CLIBASIA_05495 [Candidatus Liberib
1je5_A206 Helix-destabilizing protein; OB-fold, beta barrel, DNA 100.0
>1je5_A Helix-destabilizing protein; OB-fold, beta barrel, DNA binding protein; 1.90A {Enterobacteria phage T7} SCOP: b.40.4.7 Back     alignment and structure
Probab=100.00  E-value=2.8e-36  Score=231.82  Aligned_cols=177  Identities=19%  Similarity=0.214  Sum_probs=121.6

Q ss_pred             CCE---EEEEEEE-EEEEECCCCCCCCC-----CCCEEEEEEEECCCCHH---HHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             943---6731799-94153058624667-----78408999997766689---999999999999985403410011345
Q gi|254781192|r    1 MAK---VLIKGRL-SYPQLHEPRAYGDK-----GDEVYSADILFSKTDNE---QCDKLEQAIREAGEEKFGGSNMSALIE   68 (198)
Q Consensus         1 m~k---vt~~gr~-~y~~L~~Pd~~~~~-----~~~~Ys~~l~i~k~d~~---~~~~i~~~i~~~~~~~~~~~~~~~~~~   68 (198)
                      |+|   +|+.|++ +||||++||++|+.     .+++|||+|+|++++.+   +++.|+++++++.......   .....
T Consensus         1 m~~~~~ttp~G~a~~Y~~L~~PD~~f~~~~~~~~~g~Y~v~L~v~k~d~~a~~~~~~i~~~~~~a~~~~~~~---~~~k~   77 (206)
T 1je5_A            1 MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEE---YEANP   77 (206)
T ss_dssp             CCCSCEECCSEEECSSCEEEEEECCC---CCSCCSCEEEEEEEEETTSHHHHHHHHHHHHHHHHHHHHHHHH---HHTSC
T ss_pred             CCCEEECCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH---HCCCC
T ss_conf             984423279833340553378874433234678896389999974761789999999999999999999987---50365


Q ss_pred             CCCCCCCCCEECCCCCCCCCCCCCCCCCCCCEEEECCCC------------CCCCCEEECCCCCCCCCCCCCCCCCCCEE
Q ss_conf             554556763004866544443334541115548970578------------77686589368868236666531366289
Q gi|254781192|r   69 RMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKN------------KKVRPRLVDRHVQEVTENIQEVFYSGCHV  136 (198)
Q Consensus        69 ~~~~~~~~p~~dgD~~~~~~~~~~~~~~~~g~~~~~~~~------------~~~~P~v~Ds~g~~l~~~~~~~I~sGs~v  136 (198)
                      ......+.+.++++...+.      +.++.|.++++++.            ++++|.|||++++||++  .++|||||++
T Consensus        78 ~k~~~~k~~~~~~~~~~p~------~~e~~G~~~fk~K~Ka~~~~~k~g~~~~~~P~v~D~~~~~l~~--~~~i~~Gs~~  149 (206)
T 1je5_A           78 PAVARGKKPLKPYEGDMPF------FDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMED--VPIIGGGSKL  149 (206)
T ss_dssp             C-------CCCCCBCCCSE------EECSSSEEEEEEEEESEEECTTTCCEEECCCCEECTTSCBCSS--CCCCCTTCEE
T ss_pred             CCCCCCCCCCCCCCCCCCC------CCCCCCCEEEEEEEEEEEECCCCCCCCCCCCEEECCCCCCCCC--CCCCCCCCEE
T ss_conf             4444233577776566886------5365874899999866741155677555587079698989888--6603578689


Q ss_pred             EEEEEEEEEECC--CCEEEEEEECCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             999999787627--9756998855258974156466776754346555665422347
Q gi|254781192|r  137 NAIISVYAYTFQ--GTKGVTFTLTGVQFVKDDTRWGGQLRASSSDFESYEEETASID  191 (198)
Q Consensus       137 ~v~~~~~pY~~~--~g~GVsl~L~aVQ~i~~~e~~gg~~~~~~d~f~~~~~~~~~~~  191 (198)
                      ||++.++||+.+  .|.||||||++||||+++|+.||+..   .+|+++++++++.+
T Consensus       150 ~v~~~~~py~~~~~~g~Gvsl~L~~VQv~~~~e~~~g~~~---~~~~~~edG~~~~~  203 (206)
T 1je5_A          150 KVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDD---WADEVEENGYVASG  203 (206)
T ss_dssp             EEEEEEEEECCCSSCCBEEEEEEEEEEEEECCC------C---CGGGCSCC------
T ss_pred             EEEEEEEEEEECCCCCEEEEEEECEEEEEECCCCCCCCCC---CCCCCCCCCCCCCC
T ss_conf             9999998788659886389988366999871256787766---67644567711467




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 198 hypothetical protein CLIBASIA_05495 [Candidatus Liberib
d1je5a_197 b.40.4.7 (A:) gp2.5 {Bacteriophage T7 [TaxId: 10760]} L 4e-17
>d1je5a_ b.40.4.7 (A:) gp2.5 {Bacteriophage T7 [TaxId: 10760]} Length = 197 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Phage ssDNA-binding proteins
domain: gp2.5
species: Bacteriophage T7 [TaxId: 10760]
 Score = 81.6 bits (201), Expect = 4e-17
 Identities = 30/203 (14%), Positives = 57/203 (28%), Gaps = 24/203 (11%)

Query: 1   MAKVLIKG----RLSYPQLHEP-----RAYGDKGDEVYSADILFSKTDNE------QCDK 45
           MAK +          Y  + +P              VY  D+     D        +  K
Sbjct: 1   MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVK 60

Query: 46  LEQAIREAGEEKFGGSNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITP 105
             +    A  E++  +  +    +                  +   +     + Q   T 
Sbjct: 61  CHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTK 120

Query: 106 KNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQGTK--GVTFTLTGVQFV 163
           + K +   +VD   +++ +    +   G  +    S+  Y +       V   L  V  V
Sbjct: 121 ETKHINLVVVDSKGKKMED--VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLV 178

Query: 164 KDDTRWGGQLRASSSDFESYEEE 186
           +  T  GG       D+    EE
Sbjct: 179 ELATFGGG-----EDDWADEVEE 196


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target198 hypothetical protein CLIBASIA_05495 [Candidatus Liberib
d1je5a_197 gp2.5 {Bacteriophage T7 [TaxId: 10760]} 100.0
>d1je5a_ b.40.4.7 (A:) gp2.5 {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Phage ssDNA-binding proteins
domain: gp2.5
species: Bacteriophage T7 [TaxId: 10760]
Probab=100.00  E-value=6.6e-37  Score=234.13  Aligned_cols=160  Identities=20%  Similarity=0.259  Sum_probs=117.4

Q ss_pred             CCE---EEEEEEE-EEEEECCCCCCCCC-----CCCEEEEEEEECCCCH---HHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             943---6731799-94153058624667-----7840899999776668---9999999999999985403410011345
Q gi|254781192|r    1 MAK---VLIKGRL-SYPQLHEPRAYGDK-----GDEVYSADILFSKTDN---EQCDKLEQAIREAGEEKFGGSNMSALIE   68 (198)
Q Consensus         1 m~k---vt~~gr~-~y~~L~~Pd~~~~~-----~~~~Ys~~l~i~k~d~---~~~~~i~~~i~~~~~~~~~~~~~~~~~~   68 (198)
                      |+|   +|+.|+| +||||++||++|+.     .+|+|||+|+|+++++   ++++.|+++++++.......   .....
T Consensus         1 m~k~~~ttp~G~a~~Y~~L~kPDt~f~~~~~~~~~g~Ykv~L~v~k~d~~a~~~i~~i~~~~e~a~~~~~~~---~~~~~   77 (197)
T d1je5a_           1 MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEE---YEANP   77 (197)
T ss_dssp             CCCSCEECCSEEECSSCEEEEEECCC---CCSCCSCEEEEEEEEETTSHHHHHHHHHHHHHHHHHHHHHHHH---HHTSC
T ss_pred             CCCEEECCCCCCEECCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHH---HCCCC
T ss_conf             985533279832341543378985543334678896189999972641779999999999999999999987---53456


Q ss_pred             CCCCCCCCCEECCCCCCCCCCCCCCCCCCCCEEEECCC------------CCCCCCEEECCCCCCCCCCCCCCCCCCCEE
Q ss_conf             55455676300486654444333454111554897057------------877686589368868236666531366289
Q gi|254781192|r   69 RMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPK------------NKKVRPRLVDRHVQEVTENIQEVFYSGCHV  136 (198)
Q Consensus        69 ~~~~~~~~p~~dgD~~~~~~~~~~~~~~~~g~~~~~~~------------~~~~~P~v~Ds~g~~l~~~~~~~I~sGs~v  136 (198)
                      ......+.|.+++++..++      +.+..|.++++++            +++++|.|||++++||++  .++|||||++
T Consensus        78 ~k~~~~K~~~~p~~~~~~~------~~~~~G~~~fk~K~Ka~~~~~kt~~~~~~~P~i~Ds~~~~l~~--~~~i~~Gs~~  149 (197)
T d1je5a_          78 PAVARGKKPLKPYEGDMPF------FDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMED--VPIIGGGSKL  149 (197)
T ss_dssp             C-------CCCCCBCCCSE------EECSSSEEEEEEEEESEEECTTTCCEEECCCCEECTTSCBCSS--CCCCCTTCEE
T ss_pred             CCCCCCCCCCCCCCCCCCC------CCCCCCCEEEEEEEEEEECCCCCCCCCCCCCEEECCCCCCCCC--CCCCCCCCEE
T ss_conf             5443111356876445777------5366885899999876502456787554487379898999888--7612368689


Q ss_pred             EEEEEEEEEEC--CCCEEEEEEECCEEEEECCCCCCC
Q ss_conf             99999978762--797569988552589741564667
Q gi|254781192|r  137 NAIISVYAYTF--QGTKGVTFTLTGVQFVKDDTRWGG  171 (198)
Q Consensus       137 ~v~~~~~pY~~--~~g~GVsl~L~aVQ~i~~~e~~gg  171 (198)
                      ||++.++||+.  +.|.||||||++||||+++|+.||
T Consensus       150 ~v~~~~~py~~~~~~g~Gvsl~L~~VQvi~~~e~~gg  186 (197)
T d1je5a_         150 KVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGG  186 (197)
T ss_dssp             EEEEEEEEECCCSSCCBEEEEEEEEEEEEECCC----
T ss_pred             EEEEEEEEEEECCCCCEEEEEEEEEEEEEEECCCCCC
T ss_conf             9999985545079886389998446999881267787



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00