254781191

254781191

hypothetical protein CLIBASIA_05490

GeneID in NCBI database:8210216Locus tag:CLIBASIA_05490
Protein GI in NCBI database:254781191Protein Accession:YP_003065604.1
Gene range:+(1190024, 1190521)Protein Length:165aa
Gene description:hypothetical protein
COG prediction:[L] Site-specific recombinases, DNA invertase Pin homologs
KEGG prediction:hypothetical protein
SEED prediction:Phage protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALNVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRKKVSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKANISEFSVLKD
cccccccHHcccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccccHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHcccccHHHHHHHHccEEcccccEEEEEccccHHHHHHHHHHHHHHcc
cccccccEEEcccccHHHHHHHHHcHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccHHHHHHHHHHccccHccccccccHHHHHHHHcccccccccHHHHHHHEEccccccEEEccccHHHHHHHcHHccccccc
mdenacrfcrakprcGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALNVlssgedlpnyelkegrkgsrtynndNQVEQLLMRELGDEaynrtllsptetEQLVKRKKVSETTWEQLQKFItrkdgkqvivpcdlpvnhlkanisefsvlkd
mdenacrfcrakprcgALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALNvlssgedlpnyelkegrkgsrtynndnQVEQLLMRELGDEAYnrtllspteteqlvkrkkvsetTWEQLQkfitrkdgkqvivpcdlpvnhlkanisefsvlkd
MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALNVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRKKVSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKANISEFSVLKD
*DENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALNVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQL********TTWEQLQKFITRKDGKQVIVPCDLPVNHLKANISEFS*L**
MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALNVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRKKVSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKANISEFSVLKD
***NACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALNVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRKKVSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKANISE******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALNVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRKKVSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKANISEFSVLKD
MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALNVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRKKVSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKANISEFSVLKD
MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEALNVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRKKVSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKANISEFSVLKD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target165 hypothetical protein CLIBASIA_05490 [Candidatus Liberib
254780124388 hypothetical protein CLIBASIA_00015 [Candidatus Li 2e-34
>gi|254780124|ref|YP_003064537.1| hypothetical protein CLIBASIA_00015 [Candidatus Liberibacter asiaticus str. psy62] Length = 388 Back     alignment
 Score =  136 bits (343), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 110/165 (66%), Gaps = 2/165 (1%)

Query: 1   MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEAL 60
           +++++CRFCRAK RC AL+   L   ++     +  +LS+  + + LI++++K  ++E  
Sbjct: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMF 282

Query: 61  NVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRK 120
             L++G+++  Y+L EGRKG+R++ + N+ ++LL   LG+EA+ R L +P E EQL K +
Sbjct: 283 KRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQ 342

Query: 121 KVSETTWEQLQKFITRKDGKQVIVPCDLPVNH--LKANISEFSVL 163
           KVS+  WE+LQ+ ITR DGK VI P D+P N    K+ +SEF VL
Sbjct: 343 KVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target165 hypothetical protein CLIBASIA_05490 [Candidatus Liberib
315121963388 hypothetical protein CKC_01065 [Candidatus Liberibacter 1 8e-32
315122931388 hypothetical protein CKC_05935 [Candidatus Liberibacter 1 9e-32
254780124388 hypothetical protein CLIBASIA_00015 [Candidatus Liberib 1 8e-31
317120738388 hypothetical protein SC2_gp195 [Liberibacter phage SC2] 1 8e-31
45569531418 hypothetical protein BMP-1p37 [Bordetella phage BMP-1] 1 3e-20
41179398418 Bbp38 [Bordetella phage BPP-1] Length = 418 1 3e-20
45580782418 hypothetical protein BIP-1p37 [Bordetella phage BIP-1] 1 3e-20
15839112425 hypothetical protein XF2522 [Xylella fastidiosa 9a5c] L 1 7e-19
15837288425 hypothetical protein XF0686 [Xylella fastidiosa 9a5c] L 1 1e-18
260845236433 hypothetical protein ECO103_3129 [Escherichia coli O103 1 8e-18
>gi|315121963|ref|YP_004062452.1| hypothetical protein CKC_01065 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 388 Back     alignment and organism information
 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 103/165 (62%), Gaps = 2/165 (1%)

Query: 1   MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEAL 60
           +DE+ACRFCRAK RC AL+   L       +      LS+  + LPLIE ++K +KEE  
Sbjct: 223 VDEDACRFCRAKTRCPALSRHVLLETIRDPKSGCEVDLSKAYSSLPLIEQYIKALKEEVF 282

Query: 61  NVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRK 120
             LS GE++  Y+L EGRKG+RT+ +  Q  + L   LGD+A+ + LLSP E EQ  K +
Sbjct: 283 KRLSEGEEVKGYQLVEGRKGNRTFKDIEQATEYLTGVLGDKAFKKILLSPKEVEQFRKDQ 342

Query: 121 KVSETTWEQLQKFITRKDGKQVIVPCDL-PVNHL-KANISEFSVL 163
            +S   WE+LQ+ ITR DGK VI P D+ PV  + KA IS+F+ L
Sbjct: 343 TLSSDVWEELQELITRGDGKPVIAPRDIPPVPRIQKAEISDFASL 387


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122931|ref|YP_004063420.1| hypothetical protein CKC_05935 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 388 Back     alignment and organism information
>gi|254780124|ref|YP_003064537.1| hypothetical protein CLIBASIA_00015 [Candidatus Liberibacter asiaticus str. psy62] Length = 388 Back     alignment and organism information
>gi|317120738|gb|ADV02560.1| hypothetical protein SC2_gp195 [Liberibacter phage SC2] Length = 388 Back     alignment and organism information
>gi|45569531|ref|NP_996600.1| hypothetical protein BMP-1p37 [Bordetella phage BMP-1] Length = 418 Back     alignment and organism information
>gi|41179398|ref|NP_958707.1| Bbp38 [Bordetella phage BPP-1] Length = 418 Back     alignment and organism information
>gi|45580782|ref|NP_996648.1| hypothetical protein BIP-1p37 [Bordetella phage BIP-1] Length = 418 Back     alignment and organism information
>gi|15839112|ref|NP_299800.1| hypothetical protein XF2522 [Xylella fastidiosa 9a5c] Length = 425 Back     alignment and organism information
>gi|15837288|ref|NP_297976.1| hypothetical protein XF0686 [Xylella fastidiosa 9a5c] Length = 425 Back     alignment and organism information
>gi|260845236|ref|YP_003223014.1| hypothetical protein ECO103_3129 [Escherichia coli O103:H2 str. 12009] Length = 433 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target165 hypothetical protein CLIBASIA_05490 [Candidatus Liberib
pfam10926363 pfam10926, DUF2800, Protein of unknown function (DUF280 7e-25
>gnl|CDD|151373 pfam10926, DUF2800, Protein of unknown function (DUF2800) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 165 hypothetical protein CLIBASIA_05490 [Candidatus Liberib
pfam10926363 DUF2800 Protein of unknown function (DUF2800). This is 100.0
>pfam10926 DUF2800 Protein of unknown function (DUF2800) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00