254781194

254781194

hypothetical protein CLIBASIA_05505

GeneID in NCBI database:8210219Locus tag:CLIBASIA_05505
Protein GI in NCBI database:254781194Protein Accession:YP_003065607.1
Gene range:+(1193149, 1193445)Protein Length:98aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MRTDYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY
ccHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEcccccEEEEEEccccccccHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHcc
cccccccHHHHHHHHHHHHHHHccccccEccccccccccEEEEEccccEEEEEEccccccccHHHHHHHHHHHHcccEEEEEccHHcHHHHHHHHEcc
MRTDYLSEAKLEKRLVKGSKKLDCLVFKTQfinqrgcpdrliitpngaHFWVEMKTSRGRLSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY
mrtdylseaklekrlvkgskkldCLVFKTqfinqrgcpdrliITPNGAHFWVEMKTSRGRLSNAQKRVIATLLLYHqkvqvlssteevdGFLRMLECY
MRTDYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY
******SEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRG******KRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY
MRTDYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY
**TDYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTDYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY
MRTDYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY
MRTDYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNAQKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target98 hypothetical protein CLIBASIA_05505 [Candidatus Liberib
254780128103 VRR-NUC domain-containing protein [Candidatus Libe 1e-25
>gi|254780128|ref|YP_003064541.1| VRR-NUC domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Back     alignment
 Score =  105 bits (263), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 63/93 (67%)

Query: 5   YLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNA 64
           Y +E  +EKRLV G+KKLDC V K  F+ +RGCPDRLIITPNG  +W+E+K   GRLS+ 
Sbjct: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67

Query: 65  QKRVIATLLLYHQKVQVLSSTEEVDGFLRMLEC 97
           Q   I  L    Q+V+VL S EEVD FL  L C
Sbjct: 68  QMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target98 hypothetical protein CLIBASIA_05505 [Candidatus Liberib
255957562103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 8e-22
255957617103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 1e-21
254780128103 VRR-NUC domain-containing protein [Candidatus Liberibac 1 2e-21
255957602103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 2e-21
255957612103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 2e-21
255957557103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 2e-21
255957592103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 3e-21
315121968101 VRR-NUC domain-containing protein [Candidatus Liberibac 1 3e-21
255957662103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 4e-21
255957622103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 4e-21
>gi|255957562|dbj|BAH96623.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 64/93 (68%)

Query: 5   YLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNA 64
           Y +E  +EKRLV G++KLDC V K  F+ +RGCPDRLIITPNG  +W+E+K   GRLS+ 
Sbjct: 8   YQTEKDVEKRLVTGAEKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67

Query: 65  QKRVIATLLLYHQKVQVLSSTEEVDGFLRMLEC 97
           Q   I  LL   Q+V+VL S EEVD FL  L C
Sbjct: 68  QMSEIEELLRRGQRVKVLVSMEEVDNFLEELAC 100


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|255957617|dbj|BAH96667.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|254780128|ref|YP_003064541.1| VRR-NUC domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Back     alignment and organism information
>gi|255957602|dbj|BAH96655.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|255957612|dbj|BAH96663.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|255957557|dbj|BAH96619.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|255957592|dbj|BAH96647.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|315121968|ref|YP_004062457.1| VRR-NUC domain-containing protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 101 Back     alignment and organism information
>gi|255957662|dbj|BAH96703.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|255957622|dbj|BAH96671.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target98 hypothetical protein CLIBASIA_05505 [Candidatus Liberib
pfam0877496 pfam08774, VRR_NUC, VRR-NUC domain 8e-05
>gnl|CDD|149740 pfam08774, VRR_NUC, VRR-NUC domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 98 hypothetical protein CLIBASIA_05505 [Candidatus Liberib
pfam0877496 VRR_NUC VRR-NUC domain. 99.68
pfam0187093 Hjc Archaeal holliday junction resolvase (hjc). This fa 97.56
cd00523123 archeal_HJR Holliday junction resolvases (HJRs) are end 97.45
COG1591137 Holliday junction resolvase - archaeal type [DNA replic 96.59
PHA01753121 Holliday junction resolvase 93.4
COG2810 284 Predicted type IV restriction endonuclease [Defense mec 92.93
pfam03838167 RecU Recombination protein U. 92.51
cd00221115 Vsr Very Short Patch Repair (Vsr) Endonuclease. Endonuc 92.48
pfam0202194 UPF0102 Uncharacterized protein family UPF0102. The fun 91.27
KOG2143854 consensus 98.87
pfam10107153 Endonuc_Holl Endonuclease related to archaeal Holliday 92.12
pfam0872281 TnsA_N TnsA endonuclease N terminal. The Tn7 transposas 90.36
>pfam08774 VRR_NUC VRR-NUC domain Back     alignment and domain information
>pfam01870 Hjc Archaeal holliday junction resolvase (hjc) Back     alignment and domain information
>cd00523 archeal_HJR Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination Back     alignment and domain information
>COG1591 Holliday junction resolvase - archaeal type [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA01753 Holliday junction resolvase Back     alignment and domain information
>COG2810 Predicted type IV restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>pfam03838 RecU Recombination protein U Back     alignment and domain information
>cd00221 Vsr Very Short Patch Repair (Vsr) Endonuclease Back     alignment and domain information
>pfam02021 UPF0102 Uncharacterized protein family UPF0102 Back     alignment and domain information
>KOG2143 consensus Back     alignment and domain information
>pfam10107 Endonuc_Holl Endonuclease related to archaeal Holliday junction resolvase Back     alignment and domain information
>pfam08722 TnsA_N TnsA endonuclease N terminal Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target98 hypothetical protein CLIBASIA_05505 [Candidatus Liberib
1ob8_A135 Holliday-junction resolvase; hydrolase, enzyme, homolog 97.42
2wcw_A139 HJC; type II restriction endonuclease, hydrolase, DNA b 97.26
1gef_A123 Holliday junction resolvase; HJC, hydrolase; 2.00A {Pyr 97.23
2eo0_A147 Hypothetical protein ST1444; holliday junction resolvas 97.08
1hh1_A143 Holliday junction resolving enzyme HJC; holliday juncti 96.94
2fco_A200 Recombination protein U (penicillin-binding protein rel 94.8
1zp7_A206 Recombination protein U; recombination,DNA-binding prot 94.36
3fov_A134 UPF0102 protein RPA0323; structural genomics, APC7380, 93.2
1cw0_A155 Protein (DNA mismatch endonuclease); protein-DNA comple 93.06
2vld_A251 NUCS, UPF0286 protein pyrab01260; endonuclease, hydrola 92.08
3dnx_A153 Uncharacterized protein SPO1766; structural genomics, A 91.15
>1ob8_A Holliday-junction resolvase; hydrolase, enzyme, homologous recombination, holliday junction resolving enzyme, nuclease, archaea; 1.8A {Sulfolobus solfataricus} SCOP: c.52.1.18 PDB: 1ob9_A Back     alignment and structure
Probab=97.42  E-value=0.00092  Score=42.67  Aligned_cols=69  Identities=16%  Similarity=0.186  Sum_probs=50.9

Q ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCC--CCCCCCEEEEECCCCEEEEEEECCCCC---CCHHHHHHHHHHH-HCCC
Q ss_conf             99999999999997898899971489--887662799915991999997278988---6989999999999-7898
Q gi|254781194|r    8 EAKLEKRLVKGSKKLDCLVFKTQFIN--QRGCPDRLIITPNGAHFWVEMKTSRGR---LSNAQKRVIATLL-LYHQ   77 (98)
Q Consensus         8 E~~ie~~i~~~~k~~g~~~~k~~~~g--~~G~PDli~~~~~g~~~fIEvK~~~gk---ls~~Q~~~~~~l~-~~G~   77 (98)
                      =+..|+.++.++...|+.+++....+  ..|.||++.. +++..+|||||+-.+.   ++..|...+..+. ..|.
T Consensus         6 G~~~Er~~~~~L~~~G~~v~r~~~s~~~~~g~iDiiA~-~~~~~~~IEvKs~~~~~iy~~~eqv~~l~~f~~~~g~   80 (135)
T 1ob8_A            6 GKNAERELVSILRGEGFNAVRIPTSNSSPNPLPDIFAT-KGNTLLSIECKSTWENKVKVKEHQVRKLLDFLSMFTM   80 (135)
T ss_dssp             CHHHHHHHHHHHHHTTCEEEECCC-----CCSCSEEEE-ETTEEEEEEEEEESSSEEEECHHHHHHHHHHHHTSSS
T ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCEEEE-CCCEEEEEEEEECCCCEEECCHHHHHHHHHHHHHCCC
T ss_conf             79999999999996995899946778888899888995-3999999999963498252699999999999996385



>2wcw_A HJC; type II restriction endonuclease, hydrolase, DNA binding protein, holliday junction resolvase; 1.58A {Archaeoglobus fulgidus} PDB: 2wcz_A 2wiw_A 2wiz_A 2wj0_A Back     alignment and structure
>1gef_A Holliday junction resolvase; HJC, hydrolase; 2.00A {Pyrococcus furiosus} SCOP: c.52.1.18 PDB: 1ipi_A Back     alignment and structure
>2eo0_A Hypothetical protein ST1444; holliday junction resolvase, DNA binding protein, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1hh1_A Holliday junction resolving enzyme HJC; holliday junction resolvase, homologous recombination, nuclease domain, archaea; 2.15A {Sulfolobus solfataricus} SCOP: c.52.1.18 Back     alignment and structure
>2fco_A Recombination protein U (penicillin-binding protein related factor A); flexibility, hydrolase; 1.40A {Geobacillus kaustophilus HTA426} PDB: 1y1o_A Back     alignment and structure
>1zp7_A Recombination protein U; recombination,DNA-binding protein,resolvase, DNA binding protein; 2.25A {Bacillus subtilis} PDB: 1rzn_A Back     alignment and structure
>3fov_A UPF0102 protein RPA0323; structural genomics, APC7380, PSI-2, protein structure initiative; 1.88A {Rhodopseudomonas palustris CGA009} Back     alignment and structure
>1cw0_A Protein (DNA mismatch endonuclease); protein-DNA complex, intercalation, zinc, hydrolase/DNA; HET: DNA; 2.30A {Escherichia coli} SCOP: c.52.1.15 Back     alignment and structure
>2vld_A NUCS, UPF0286 protein pyrab01260; endonuclease, hydrolase; 2.60A {Pyrococcus abyssi} Back     alignment and structure
>3dnx_A Uncharacterized protein SPO1766; structural genomics, APC88088, protein of unknown function, PSI-2, protein structure initiative; HET: MSE; 1.94A {Silicibacter pomeroyi} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target98 hypothetical protein CLIBASIA_05505 [Candidatus Liberib
d1ob8a_124 Holliday-junction resolvase SSO1176 {Sulfolobus solfata 97.51
d1hh1a_132 Archaeal Holliday junction resolvase Hjc {Archaeon Sulf 97.09
d1gefa_120 Archaeal Holliday junction resolvase Hjc {Archaeon Pyro 96.04
d1rzna_165 Recombination protein U (RecU)/PBP related factor A (Pr 94.43
d1y1oa_168 Recombination protein U (RecU)/PBP related factor A (Pr 94.0
>d1ob8a_ c.52.1.18 (A:) Holliday-junction resolvase SSO1176 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Restriction endonuclease-like
superfamily: Restriction endonuclease-like
family: Hjc-like
domain: Holliday-junction resolvase SSO1176
species: Sulfolobus solfataricus [TaxId: 2287]
Probab=97.51  E-value=0.00067  Score=42.09  Aligned_cols=67  Identities=16%  Similarity=0.155  Sum_probs=54.1

Q ss_pred             HHHHHHHHHHHHHCCCEEEEEECCC--CCCCCCEEEEECCCCEEEEEEECCCCC---CCHHHHHHHHHHHHCC
Q ss_conf             9999999999997898899971489--887662799915991999997278988---6989999999999789
Q gi|254781194|r    9 AKLEKRLVKGSKKLDCLVFKTQFIN--QRGCPDRLIITPNGAHFWVEMKTSRGR---LSNAQKRVIATLLLYH   76 (98)
Q Consensus         9 ~~ie~~i~~~~k~~g~~~~k~~~~g--~~G~PDli~~~~~g~~~fIEvK~~~gk---ls~~Q~~~~~~l~~~G   76 (98)
                      +..|+.++..+...|+.++...++|  .++.||++... ++.++.||+|...+.   ++..|...+..+....
T Consensus         2 ~~~ERelv~~l~~~gf~vvR~~gSGs~~~~~pDllA~~-~~~~~~IEvKst~~~kiyi~~eqie~L~~f~~~f   73 (124)
T d1ob8a_           2 KNAERELVSILRGEGFNAVRIPTSNSSPNPLPDIFATK-GNTLLSIECKSTWENKVKVKEHQVRKLLDFLSMF   73 (124)
T ss_dssp             HHHHHHHHHHHHHTTCEEEECCC-----CCSCSEEEEE-TTEEEEEEEEEESSSEEEECHHHHHHHHHHHHTS
T ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCEEEEC-CCEEEEEEEEECCCCEEEECHHHHHHHHHHHHHC
T ss_conf             56999999999869943999235789888898789857-9869999998535985998799999999999971



>d1hh1a_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gefa_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rzna_ c.52.1.28 (A:) Recombination protein U (RecU)/PBP related factor A (PrfA) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y1oa_ c.52.1.28 (A:) Recombination protein U (RecU)/PBP related factor A (PrfA) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target98 hypothetical protein CLIBASIA_05505 [Candidatus Liberib
2eo0_A_147 Hypothetical protein ST1444; holliday junction res 97.6
1gef_A_123 Holliday junction resolvase; HJC, hydrolase; 2.00A 97.59
2wcw_A_139 HJC; type II restriction endonuclease, hydrolase, 97.56
1hh1_A_143 Holliday junction resolving enzyme HJC; holliday j 97.48
3h1t_A_1-169_362-370178 Type I site-specific restriction-modification syst 96.7
2fco_A_200 Recombination protein U (penicillin-binding protei 95.42
2w00_A_1-54_129-248174 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 95.18
2vld_A_122-251130 NUCS, UPF0286 protein pyrab01260; endonuclease, hy 94.98
1zp7_A_206 Recombination protein U; recombination,DNA-binding 94.97
3dnx_A_153 Uncharacterized protein SPO1766; structural genomi 94.56
3fov_A_134 UPF0102 protein RPA0323; structural genomics, APC7 93.31
2v9k_A_1-410410 Uncharacterized protein FLJ32312; pseudouridine sy 92.01
>2eo0_A (A:) Hypothetical protein ST1444; holliday junction resolvase, DNA binding protein, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
Probab=97.60  E-value=0.00053  Score=44.96  Aligned_cols=81  Identities=14%  Similarity=0.220  Sum_probs=62.9

Q ss_pred             CCCHHCCHHHHHHHHHHHHHHCCCEEEEEECCCC---CCCCCEEEEECCCCEEEEEEECC-CCC---CCHHHHHHHHHHH
Q ss_conf             9501205999999999999978988999714898---87662799915991999997278-988---6989999999999
Q gi|254781194|r    1 MRTDYLSEAKLEKRLVKGSKKLDCLVFKTQFINQ---RGCPDRLIITPNGAHFWVEMKTS-RGR---LSNAQKRVIATLL   73 (98)
Q Consensus         1 ~~~~~m~E~~ie~~i~~~~k~~g~~~~k~~~~g~---~G~PDli~~~~~g~~~fIEvK~~-~gk---ls~~Q~~~~~~l~   73 (98)
                      |++.+++=+..|+.|++.+...|+.++...++|.   +-.||++... ++.++.||+|.. ++.   +...|..-+-.+.
T Consensus         4 ~~~~~~kG~~~EReL~~~L~~~Gfav~R~p~Sgg~~~~~~pDiiA~~-~~~~~~iEvKst~k~~~iyi~~eqvekL~~f~   82 (147)
T 2eo0_A            4 VNSNKSRGSSVERYIVSRLRDKGFAVIRAPASGSKRKDHVPDIIALK-SGVIILIEVKSRKNGQKIYIEKEQAEGIREFA   82 (147)
T ss_dssp             --------CHHHHHHHHHHHHTTCEEECC-----CCGGGSCSEEEEE-TTEEEEEEEEECCCC-CEEECHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCEEECC-CCCEEEEEEEECCCCCCCCCCHHHHHHHHHHH
T ss_conf             31203353399999999999779867970145776788888625037-98379999987156875346999999999999


Q ss_pred             -HCCCEEEEE
Q ss_conf             -789869998
Q gi|254781194|r   74 -LYHQKVQVL   82 (98)
Q Consensus        74 -~~G~~~~Vv   82 (98)
                       ..|+..+++
T Consensus        83 ~~fg~~p~iA   92 (147)
T 2eo0_A           83 KRSGGELFLG   92 (147)
T ss_dssp             HHHTCEEEEE
T ss_pred             HHCCCEEEEE
T ss_conf             9679938999



>1gef_A (A:) Holliday junction resolvase; HJC, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2wcw_A (A:) HJC; type II restriction endonuclease, hydrolase, DNA binding protein, holliday junction resolvase; 1.58A {Archaeoglobus fulgidus} PDB: 2wcz_A 2wiw_A 2wiz_A 2wj0_A Back     alignment and structure
>1hh1_A (A:) Holliday junction resolving enzyme HJC; holliday junction resolvase, homologous recombination, nuclease domain, archaea; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>3h1t_A (A:1-169,A:362-370) Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2fco_A (A:) Recombination protein U (penicillin-binding protein related factor A); flexibility, hydrolase; 1.40A {Geobacillus kaustophilus HTA426} PDB: 1y1o_A Back     alignment and structure
>2w00_A (A:1-54,A:129-248) HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, plasmid, helicase, hydrolase, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} Back     alignment and structure
>2vld_A (A:122-251) NUCS, UPF0286 protein pyrab01260; endonuclease, hydrolase; 2.60A {Pyrococcus abyssi} Back     alignment and structure
>1zp7_A (A:) Recombination protein U; recombination,DNA-binding protein,resolvase, DNA binding protein; 2.25A {Bacillus subtilis} PDB: 1rzn_A Back     alignment and structure
>3dnx_A (A:) Uncharacterized protein SPO1766; structural genomics, APC88088, protein of unknown function, PSI-2, protein structure initiative; HET: MSE; 1.94A {Silicibacter pomeroyi} Back     alignment and structure
>3fov_A (A:) UPF0102 protein RPA0323; structural genomics, APC7380, PSI-2, protein structure initiative; 1.88A {Rhodopseudomonas palustris CGA009} Back     alignment and structure
>2v9k_A (A:1-410) Uncharacterized protein FLJ32312; pseudouridine synthase, PUS10, RNA modification, thump domain, lyase; HET: EPE; 2.0A {Homo sapiens} Back     alignment and structure