255764515

255764515

SNF2 related

GeneID in NCBI database:8210220Locus tag:CLIBASIA_05510
Protein GI in NCBI database:255764515Protein Accession:YP_003065608.2
Gene range:+(1193442, 1194818)Protein Length:458aa
Gene description:SNF2 related
COG prediction:[K] [L] Superfamily II DNA/RNA helicases, SNF2 family
KEGG prediction:SNF2 related
SEED prediction:DNA helicase, phage-associated
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
ccccHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHcccccEEEEcHHHHHHHHHHHHccccccEEEEEcHHHcccccccHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHEEccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHcccccccHHHcHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccEEEEEHHHHccccccHHccEEEEEccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccccc
cccHHHHHHHHHHHHcccccccEccccccHHHHHHHHHHHHHHHccccEEEEEEHHHHccccHHHHHHccccccEEEEEEEccHHHHHHHHcccccEEEEcHHHHHHHHHHHHHccccEEEEEEccHHccccccccccHHHHHHHHHEEccccEEEEccccccccHHHHHHHHHHHccccEEcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHHHHccHcccccHHHHHHHHHHHHHHHHHHcccccccccccEEEccccHHHHHHHHHHHHccccEEEEHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEEEEcccccccccHHccccEEEEEcccccHHHHHHHHHHccccHHHHccccccEEEEEEEEcccHHHHHHHHHHHHHcHHHHHHHHccccEEEc
mnlaphqtKIVDWILDHKRCaiwasmgsgkTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELkgtwpfativvdestklksfRLRQGSKTARALakpaweserfieltgtpspnglidlwGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLsldiadyqnidkpilitkkvplpqpvmkQYHKFQRELYCDLQGENIEAFNSASKTVKCLQlangavyydeeKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKafpqgrtldkdpctiqewnegkipllfahpascghglnlqyggNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVqrwsnfshmnisvITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIvvdestklksfrlrqgsktaralakpawesERFIELtgtpspnglIDLWGQIWFLDKGKRLGRVFQSFVARWFNttqigshigaVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLlnalkketihv
MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIG*****VRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQR***************SASKTVKCLQLANGAVYYDE*********EKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFP**************WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK******
MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRL*************AWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIH*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWxxxxxxxxxxxxxxxxxxxxxPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target458 SNF2 related [Candidatus Liberibacter asiaticus str. ps
254780130205 hypothetical protein CLIBASIA_00045 [Candidatus Li 1e-122
254780129220 hypothetical protein CLIBASIA_00040 [Candidatus Li 4e-79
>gi|254780130|ref|YP_003064543.1| hypothetical protein CLIBASIA_00045 [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Back     alignment
 Score =  430 bits (1105), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 254 MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE 313
           MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE
Sbjct: 1   MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE 60

Query: 314 VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG 373
           VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG
Sbjct: 61  VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG 120

Query: 374 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 433
           HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV
Sbjct: 121 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 180

Query: 434 LQRLRTKSTIQDLLLNALKKETIHV 458
           LQRLRTKSTIQDLLLNALKKETIHV
Sbjct: 181 LQRLRTKSTIQDLLLNALKKETIHV 205

>gi|254780129|ref|YP_003064542.1| hypothetical protein CLIBASIA_00040 [Candidatus Liberibacter asiaticus str. psy62] Length = 220 Back     alignment
 Score =  286 bits (733), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 166/216 (76%), Gaps = 1/216 (0%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVW 62
           L PHQ  +V+W+L H RCA+WASMGSGKTVSVL ALS I +   + VL+IAPLRVAQ VW
Sbjct: 5   LKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVW 64

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
             EV+RWS FS M +S + G+ +QR K L TPA LY+INFEN+ WLV+     W FATIV
Sbjct: 65  KDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIV 124

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181
           VDESTKLKSFR  QG+K  RAL K A+   +RFIELTGTPSPNGLIDLWGQIWFLDKGKR
Sbjct: 125 VDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKR 184

Query: 182 LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKE 217
           LG  F+SFV RWF+T Q+GS IGAV++  K  AQKE
Sbjct: 185 LGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE 220

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target458 SNF2 related [Candidatus Liberibacter asiaticus str. ps
317120757460 SNF2 Dead box helicase [Candidatus Liberibacter asiatic 1 0.0
317120700461 SNF2 Dead box helicase [Liberibacter phage SC1] Length 1 0.0
317120844461 SNF2 Dead box helicase [Candidatus Liberibacter asiatic 1 0.0
315122937456 SNF2 related protein [Candidatus Liberibacter solanacea 1 0.0
315121969456 SNF2 related protein [Candidatus Liberibacter solanacea 1 0.0
41179407464 Bbp47 [Bordetella phage BPP-1] Length = 464 1 1e-146
71276270472 SNF2-related [Xylella fastidiosa Dixon] Length = 472 1 1e-140
71900964472 SNF2-related [Xylella fastidiosa Ann-1] Length = 472 1 1e-139
71274496472 SNF2-related [Xylella fastidiosa Dixon] Length = 472 1 1e-139
71902063472 SNF2-related [Xylella fastidiosa Ann-1] Length = 472 1 1e-138
>gi|317120757|gb|ADV02578.1| SNF2 Dead box helicase [Candidatus Liberibacter asiaticus] Length = 460 Back     alignment and organism information
 Score =  949 bits (2452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/458 (99%), Positives = 458/458 (100%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS 60
           +NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS
Sbjct: 3   LNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS 62

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
           VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT
Sbjct: 63  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 122

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK
Sbjct: 123 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 182

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP
Sbjct: 183 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 242

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH
Sbjct: 243 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 302

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG
Sbjct: 303 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 362

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV
Sbjct: 363 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 422

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV 458
           YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
Sbjct: 423 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV 460


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|317120700|gb|ADV02523.1| SNF2 Dead box helicase [Liberibacter phage SC1] Length = 461 Back     alignment and organism information
>gi|317120844|gb|ADV02665.1| SNF2 Dead box helicase [Candidatus Liberibacter asiaticus] Length = 461 Back     alignment and organism information
>gi|315122937|ref|YP_004063426.1| SNF2 related protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 456 Back     alignment and organism information
>gi|315121969|ref|YP_004062458.1| SNF2 related protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 456 Back     alignment and organism information
>gi|41179407|ref|NP_958716.1| Bbp47 [Bordetella phage BPP-1] Length = 464 Back     alignment and organism information
>gi|71276270|ref|ZP_00652548.1| SNF2-related [Xylella fastidiosa Dixon] Length = 472 Back     alignment and organism information
>gi|71900964|ref|ZP_00683077.1| SNF2-related [Xylella fastidiosa Ann-1] Length = 472 Back     alignment and organism information
>gi|71274496|ref|ZP_00650784.1| SNF2-related [Xylella fastidiosa Dixon] Length = 472 Back     alignment and organism information
>gi|71902063|ref|ZP_00684103.1| SNF2-related [Xylella fastidiosa Ann-1] Length = 472 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target458 SNF2 related [Candidatus Liberibacter asiaticus str. ps
KOG1000689 KOG1000, KOG1000, KOG1000, Chromatin remodeling protein 2e-14
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 f 9e-20
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 5e-12
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 5e-08
KOG0387 923 KOG0387, KOG0387, KOG0387, Transcription-coupled repair 4e-07
KOG0384 1373 KOG0384, KOG0384, KOG0384, Chromodomain-helicase DNA-bi 2e-06
KOG0386 1157 KOG0386, KOG0386, KOG0386, Chromatin remodeling complex 7e-06
KOG0391 1958 KOG0391, KOG0391, KOG0391, SNF2 family DNA-dependent AT 3e-04
pfam00176295 pfam00176, SNF2_N, SNF2 family N-terminal domain 8e-12
KOG0385 971 KOG0385, KOG0385, KOG0385, Chromatin remodeling complex 4e-09
pfam00270167 pfam00270, DEAD, DEAD/DEAH box helicase 9e-06
KOG0390776 KOG0390, KOG0390, KOG0390, DNA repair protein, SNF2 fam 2e-05
KOG1015 1567 KOG1015, KOG1015, KOG1015, Transcription regulator XNP/ 2e-04
KOG0392 1549 KOG0392, KOG0392, KOG0392, SNF2 family DNA-dependent AT 4e-04
KOG03921549 KOG0392, KOG0392, KOG0392, SNF2 family DNA-dependent AT 0.002
pfam04851103 pfam04851, ResIII, Type III restriction enzyme, res sub 0.004
>gnl|CDD|36218 KOG1000, KOG1000, KOG1000, Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|30899 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|28927 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|35608 KOG0387, KOG0387, KOG0387, Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription, Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|35605 KOG0384, KOG0384, KOG0384, Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>gnl|CDD|35607 KOG0386, KOG0386, KOG0386, Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics, Transcription] Back     alignment and domain information
>gnl|CDD|35612 KOG0391, KOG0391, KOG0391, SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|143942 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|35606 KOG0385, KOG0385, KOG0385, Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>gnl|CDD|144015 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|35611 KOG0390, KOG0390, KOG0390, DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|36233 KOG1015, KOG1015, KOG1015, Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>gnl|CDD|35613 KOG0392, KOG0392, KOG0392, SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>gnl|CDD|35613 KOG0392, KOG0392, KOG0392, SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>gnl|CDD|147155 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 458 SNF2 related [Candidatus Liberibacter asiaticus str. ps
KOG0385 971 consensus 100.0
KOG0384 1373 consensus 100.0
KOG0389941 consensus 100.0
KOG03921549 consensus 100.0
KOG0387 923 consensus 100.0
KOG0390776 consensus 100.0
KOG0391 1958 consensus 100.0
KOG03881185 consensus 100.0
KOG4439901 consensus 100.0
KOG0386 1157 consensus 100.0
KOG1015 1567 consensus 100.0
KOG1000689 consensus 100.0
KOG1002791 consensus 100.0
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 100.0
PRK04914 955 ATP-dependent helicase HepA; Validated 100.0
KOG1016 1387 consensus 100.0
KOG1001674 consensus 100.0
PRK13766 764 Hef nuclease; Provisional 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recombinati 100.0
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 100.0
KOG0354 746 consensus 100.0
TIGR00603756 rad25 DNA repair helicase rad25; InterPro: IPR001161 Xe 100.0
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 99.96
PRK13767 878 ATP-dependent helicase; Provisional 99.95
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 99.95
KOG1123776 consensus 99.95
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 99.95
PRK04537 574 ATP-dependent RNA helicase RhlB; Provisional 99.95
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 99.94
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.94
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.93
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 99.93
PTZ00110602 helicase; Provisional 99.93
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 99.92
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 99.9
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 99.9
KOG0331519 consensus 99.89
COG1205 851 Distinct helicase family with a unique C-terminal domai 99.88
COG1200677 RecG RecG-like helicase [DNA replication, recombination 99.88
KOG0330476 consensus 99.85
TIGR00580 997 mfd transcription-repair coupling factor; InterPro: IPR 99.84
KOG0952 1230 consensus 99.82
TIGR01389 607 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR0062 99.82
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, reco 99.81
COG1202 830 Superfamily II helicase, archaea-specific [General func 99.79
KOG0350620 consensus 99.78
KOG0333673 consensus 99.75
KOG0328400 consensus 99.7
KOG0343 758 consensus 99.7
KOG0347 731 consensus 99.65
KOG0342543 consensus 99.63
KOG0348 708 consensus 99.58
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 99.54
KOG0326459 consensus 99.46
KOG0339 731 consensus 99.45
KOG0334 997 consensus 99.36
KOG0327397 consensus 99.22
pfam00176295 SNF2_N SNF2 family N-terminal domain. This domain is fo 100.0
KOG0298 1394 consensus 100.0
PRK00254 717 ski2-like helicase; Provisional 99.95
PRK01172 674 ski2-like helicase; Provisional 99.95
PRK02362 736 ski2-like helicase; Provisional 99.94
COG1204 766 Superfamily II helicase [General function prediction on 99.92
smart00487201 DEXDc DEAD-like helicases superfamily. 99.9
PRK106891148 transcription-repair coupling factor; Provisional 99.85
pfam04851103 ResIII Type III restriction enzyme, res subunit. 99.85
COG4889 1518 Predicted helicase [General function prediction only] 99.84
COG11971139 Mfd Transcription-repair coupling factor (superfamily I 99.83
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 99.79
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 99.79
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 99.73
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 99.64
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 99.6
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 99.56
TIGR00348813 hsdR type I site-specific deoxyribonuclease, HsdR famil 99.53
PRK05580699 primosome assembly protein PriA; Validated 99.52
COG0610 962 Type I site-specific restriction-modification system, R 99.51
KOG0947 1248 consensus 99.49
KOG4284 980 consensus 99.45
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 99.33
KOG0949 1330 consensus 99.25
KOG0948 1041 consensus 99.21
KOG0346569 consensus 99.11
KOG0950 1008 consensus 99.1
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.07
KOG0353 695 consensus 99.07
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 99.0
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 98.98
KOG0337529 consensus 98.85
PRK09200 799 preprotein translocase subunit SecA; Reviewed 98.79
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 98.55
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 98.53
PRK10875607 recD exonuclease V subunit alpha; Provisional 98.41
PRK09694878 hypothetical protein; Provisional 98.37
TIGR01447753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 98.36
COG3587 985 Restriction endonuclease [Defense mechanisms] 98.35
PRK10536262 hypothetical protein; Provisional 98.29
KOG0329387 consensus 98.27
KOG0922 674 consensus 98.2
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, RNA h 98.19
TIGR00595524 priA primosomal protein N'; InterPro: IPR005259 All pro 98.0
pfam02399 829 Herpes_ori_bp Origin of replication binding protein. Th 97.9
pfam05621302 TniB Bacterial TniB protein. This family consists of se 97.69
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 97.68
KOG0920 924 consensus 97.65
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 97.63
KOG0924 1042 consensus 97.59
pfam05876552 Terminase_GpA Phage terminase large subunit (GpA). This 97.57
PRK05563541 DNA polymerase III subunits gamma and tau; Validated 97.5
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 97.43
PRK08769319 DNA polymerase III subunit delta'; Validated 97.38
PRK08451523 DNA polymerase III subunits gamma and tau; Validated 97.27
PRK07940395 DNA polymerase III subunit delta'; Validated 97.27
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 97.25
PRK13889 992 conjugal transfer relaxase TraA; Provisional 97.25
PRK06305462 DNA polymerase III subunits gamma and tau; Validated 97.25
KOG0923 902 consensus 97.23
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 97.17
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 97.1
KOG0926 1172 consensus 97.09
PRK08058329 DNA polymerase III subunit delta'; Validated 97.07
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 97.04
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 96.93
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.91
PRK07993334 DNA polymerase III subunit delta'; Validated 96.78
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 96.76
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 96.55
TIGR01970 858 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IP 96.5
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 96.44
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 96.42
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 96.4
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 96.17
pfam04466387 Terminase_3 Phage terminase large subunit. Initiation o 96.07
PRK07276290 DNA polymerase III subunit delta'; Validated 95.99
CHL00181287 cbbX CbbX; Provisional 95.98
COG1435201 Tdk Thymidine kinase [Nucleotide transport and metaboli 95.98
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 95.87
KOG0739439 consensus 95.81
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 95.61
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 95.58
pfam03237380 Terminase_6 Terminase-like family. This family represen 95.2
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 95.17
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 95.11
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 95.0
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 94.38
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 94.2
TIGR02768888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 93.53
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 92.74
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 92.72
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 91.28
COG3972660 Superfamily I DNA and RNA helicases [General function p 90.76
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 90.07
KOG0383696 consensus 100.0
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 99.94
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.91
COG4096 875 HsdR Type I site-specific restriction-modification syst 99.88
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.8
TIGR00614 497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 99.8
KOG0338 691 consensus 99.72
KOG0340442 consensus 99.67
KOG0335482 consensus 99.64
KOG0351 941 consensus 99.61
KOG0345 567 consensus 99.59
KOG0951 1674 consensus 99.58
KOG0344593 consensus 99.57
KOG0332477 consensus 99.22
KOG0352 641 consensus 99.2
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 99.78
KOG0336629 consensus 99.55
KOG0341610 consensus 99.47
TIGR02621 975 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-sub 99.4
TIGR01587424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 99.34
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 99.33
PRK05298657 excinuclease ABC subunit B; Provisional 99.31
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polymerase 99.19
COG0556663 UvrB Helicase subunit of the DNA excision repair comple 99.15
KOG0953 700 consensus 98.65
KOG0349725 consensus 98.4
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 97.65
PRK09694 878 hypothetical protein; Provisional 94.05
KOG4150 1034 consensus 92.43
KOG1513 1300 consensus 99.5
TIGR00596 939 rad1 DNA repair protein (rad1); InterPro: IPR006167 All 92.41
PRK06321472 replicative DNA helicase; Provisional 92.28
PRK08082453 consensus 91.93
PRK08760476 replicative DNA helicase; Provisional 91.69
PRK05595444 replicative DNA helicase; Provisional 91.21
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 99.43
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 99.34
PRK09401 1176 reverse gyrase; Reviewed 99.24
PRK12906 823 secA preprotein translocase subunit SecA; Reviewed 98.9
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.78
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.75
PRK12904 833 preprotein translocase subunit SecA; Reviewed 98.74
PRK12903 885 secA preprotein translocase subunit SecA; Reviewed 98.69
PRK12898673 secA preprotein translocase subunit SecA; Reviewed 98.65
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.58
PRK12326 775 preprotein translocase subunit SecA; Reviewed 98.53
CHL00122 891 secA preprotein translocase subunit SecA; Validated 98.49
PRK12900 983 secA preprotein translocase subunit SecA; Reviewed 98.37
KOG09511674 consensus 98.25
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 98.12
PRK12899 969 secA preprotein translocase subunit SecA; Reviewed 97.94
KOG18051100 consensus 97.74
PRK12901 1111 secA preprotein translocase subunit SecA; Reviewed 97.72
TIGR00963 904 secA preprotein translocase, SecA subunit; InterPro: IP 97.69
PRK12902 946 secA preprotein translocase subunit SecA; Reviewed 97.64
PRK05707328 DNA polymerase III subunit delta'; Validated 97.62
pfam07517381 SecA_DEAD SecA DEAD-like domain. SecA protein binds to 97.48
PRK09112352 DNA polymerase III subunit delta'; Validated 97.26
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 97.08
PRK06871324 DNA polymerase III subunit delta'; Validated 96.77
PRK07471363 DNA polymerase III subunit delta'; Validated 96.72
PRK06090319 DNA polymerase III subunit delta'; Validated 96.68
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 96.59
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 95.95
PRK08699325 DNA polymerase III subunit delta'; Validated 95.78
pfam02702211 KdpD Osmosensitive K+ channel His kinase sensor domain. 94.86
PRK10490 895 sensor protein KdpD; Provisional 93.1
PRK08074932 bifunctional ATP-dependent DNA helicase/DNA polymerase 99.42
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 98.03
PRK08939306 primosomal protein DnaI; Reviewed 95.41
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 95.37
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 99.25
smart0049082 HELICc helicase superfamily c-terminal domain. 99.18
smart00492141 HELICc3 helicase superfamily c-terminal domain. 95.36
CHL00195491 ycf46 Ycf46; Provisional 91.37
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 91.34
smart00491142 HELICc2 helicase superfamily c-terminal domain. 91.12
COG1199 654 DinG Rad3-related DNA helicases [Transcription / DNA re 99.16
KOG1802935 consensus 98.74
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 98.57
KOG1803649 consensus 98.4
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 97.7
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.68
PRK12402337 replication factor C small subunit 2; Reviewed 97.63
KOG0989346 consensus 97.58
PRK00440318 rfc replication factor C small subunit; Reviewed 97.53
PRK12377248 putative replication protein; Provisional 97.22
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.21
PRK09183258 transposase/IS protein; Provisional 97.11
PRK06526254 transposase; Provisional 97.11
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 97.09
COG1484254 DnaC DNA replication protein [DNA replication, recombin 96.98
PRK08181269 transposase; Validated 96.88
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 96.81
PRK08116262 hypothetical protein; Validated 96.79
COG3421 812 Uncharacterized protein conserved in bacteria [Function 96.74
smart00382148 AAA ATPases associated with a variety of cellular activ 96.58
pfam12340229 DUF3638 Protein of unknown function (DUF3638). This dom 96.54
KOG0740428 consensus 96.49
TIGR01074 677 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 96.4
PRK05564313 DNA polymerase III subunit delta'; Validated 96.33
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 96.11
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.1
PRK10865 857 protein disaggregation chaperone; Provisional 95.97
PRK06964342 DNA polymerase III subunit delta'; Validated 95.85
KOG0737386 consensus 95.84
PRK04296197 thymidine kinase; Provisional 95.84
PRK03992390 proteasome-activating nucleotidase; Provisional 95.69
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 95.68
PRK07952242 DNA replication protein DnaC; Validated 95.65
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 95.64
pfam00004131 AAA ATPase family associated with various cellular acti 95.63
PRK11773 722 uvrD DNA-dependent helicase II; Provisional 95.58
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 95.54
PRK07399314 DNA polymerase III subunit delta'; Validated 95.5
cd01124187 KaiC KaiC is a circadian clock protein primarily found 95.48
PRK06921265 hypothetical protein; Provisional 95.43
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 95.17
pfam00265175 TK Thymidine kinase. 95.0
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 94.99
PRK11054684 helD DNA helicase IV; Provisional 94.97
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA replicati 94.91
KOG0991333 consensus 94.88
CHL00095 823 clpC Clp protease ATP binding subunit 94.88
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 94.84
PRK04132 863 replication factor C small subunit; Provisional 94.77
pfam06745231 KaiC KaiC. This family represents a conserved region wi 94.77
pfam03354473 Terminase_1 Phage Terminase. The majority of the member 94.75
PRK05917290 DNA polymerase III subunit delta'; Validated 94.61
cd03115173 SRP The signal recognition particle (SRP) mediates the 94.58
PRK04328250 hypothetical protein; Provisional 94.55
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 94.54
KOG1807 1025 consensus 94.48
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 94.48
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 94.33
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 94.06
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 93.66
TIGR00345330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 93.4
KOG1131 755 consensus 93.39
pfam01935218 DUF87 Domain of unknown function DUF87. The function of 93.38
CHL00176631 ftsH cell division protein; Validated 93.06
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 92.99
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 92.96
COG4626546 Phage terminase-like protein, large subunit [General fu 92.94
TIGR00631 667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 92.86
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 92.54
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 92.11
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 91.83
PHA00350402 putative assembly protein 91.79
PRK07132303 DNA polymerase III subunit delta'; Validated 91.71
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 91.63
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 91.57
COG3973747 Superfamily I DNA and RNA helicases [General function p 91.26
pfam05872504 DUF853 Bacterial protein of unknown function (DUF853). 90.76
PRK13765 637 ATP-dependent protease Lon; Provisional 90.72
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 90.47
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 90.38
PRK08533230 flagellar accessory protein FlaH; Reviewed 90.37
TIGR01407944 dinG_rel DnaQ family exonuclease/DinG family helicase, 99.15
TIGR00604813 rad3 DNA repair helicase (rad3); InterPro: IPR013020 Al 96.54
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.69
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.69
KOG1132 945 consensus 97.23
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, predi 95.98
PRK13342417 recombination factor protein RarA; Reviewed 95.21
PRK13341 726 recombination factor protein RarA/unknown domain fusion 94.87
TIGR00604 813 rad3 DNA repair helicase (rad3); InterPro: IPR013020 Al 94.78
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 94.73
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 94.73
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 93.81
PRK10263 1355 DNA translocase FtsK; Provisional 92.58
KOG0731774 consensus 91.79
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 91.54
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 90.55
PRK04195403 replication factor C large subunit; Provisional 97.24
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 96.19
KOG0925 699 consensus 96.11
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 91.4
pfam11496278 HDA2-3 Class II histone deacetylase complex subunits 2 97.15
KOG0952 1230 consensus 97.11
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 95.13
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.91
KOG0742630 consensus 96.04
PRK10416499 cell division protein FtsY; Provisional 90.35
KOG0738491 consensus 96.7
PRK10436461 hypothetical protein; Provisional 93.36
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.18
PRK06835330 DNA replication protein DnaC; Validated 96.08
pfam06733168 DEAD_2 DEAD_2. This represents a conserved region withi 94.5
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 94.47
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 91.64
>KOG0385 consensus Back     alignment and domain information
>KOG0384 consensus Back     alignment and domain information
>KOG0389 consensus Back     alignment and domain information
>KOG0392 consensus Back     alignment and domain information
>KOG0387 consensus Back     alignment and domain information
>KOG0390 consensus Back     alignment and domain information
>KOG0391 consensus Back     alignment and domain information
>KOG0388 consensus Back     alignment and domain information
>KOG4439 consensus Back     alignment and domain information
>KOG0386 consensus Back     alignment and domain information
>KOG1015 consensus Back     alignment and domain information
>KOG1000 consensus Back     alignment and domain information
>KOG1002 consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1016 consensus Back     alignment and domain information
>KOG1001 consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354 consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25; InterPro: IPR001161 Xeroderma pigmentosum (XP) is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG1123 consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG; InterPro: IPR004609 The ATP-dependent DNA helicase RecG 3 Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0331 consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0330 consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor; InterPro: IPR004576 All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transcribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene Back     alignment and domain information
>KOG0952 consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR006293 The ATP-dependent DNA helicase RecQ (3 Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0350 consensus Back     alignment and domain information
>KOG0333 consensus Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>KOG0343 consensus Back     alignment and domain information
>KOG0347 consensus Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>KOG0348 consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0326 consensus Back     alignment and domain information
>KOG0339 consensus Back     alignment and domain information
>KOG0334 consensus Back     alignment and domain information
>KOG0327 consensus Back     alignment and domain information
>pfam00176 SNF2_N SNF2 family N-terminal domain Back     alignment and domain information
>KOG0298 consensus Back     alignment and domain information