254781198

254781198

guanylate kinase

GeneID in NCBI database:8210223Locus tag:CLIBASIA_05525
Protein GI in NCBI database:254781198Protein Accession:YP_003065611.1
Gene range:+(1195911, 1196264)Protein Length:117aa
Gene description:guanylate kinase
COG prediction:[F] Guanylate kinase
KEGG prediction:guanylate kinase
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF
ccHHHHHHHHccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHEEEEEEEEEEEEHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccc
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHEEEEEEEEEEEHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccc
mnsmerrsvmdtnhkgsnlppeeiKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF
mnsmerrsvmdtnhkgsnlppeeikNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF
MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF
***********************IKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF
************NHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF
****************SNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDxxxxxxxxxxxxxxxxxxxxxMLGLIWKIPATAIGISICLRFLANVMDKGIHLF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target117 guanylate kinase [Candidatus Liberibacter asiaticus str
25478033988 hypothetical protein CLIBASIA_01120 [Candidatus Li 5e-04
254781224103 hypothetical protein CLIBASIA_05655 [Candidatus Li 0.017
>gi|254780339|ref|YP_003064752.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] Length = 88 Back     alignment
 Score = 34.7 bits (78), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 51  TKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGIS 100
           + L EAI +NR +IAN+R +++   ++   +++E+  + WKI  T IG S
Sbjct: 8   SNLKEAITNNRVEIANIRADMSGTSMK---IQSEINNMSWKILTTMIGCS 54

>gi|254781224|ref|YP_003065637.1| hypothetical protein CLIBASIA_05655 [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Back     alignment
 Score = 29.6 bits (65), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 20/84 (23%)

Query: 31 RITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIE----VANVRIEVANVRTEM- 85
          R T LE     L+ K +     L +   + ++DIANVR E    +A+VR E+A  ++E+ 
Sbjct: 18 RFTKLETALPYLATKAD-----LADVRTELKQDIANVRTELKADIADVRTELACTKSELK 72

Query: 86 ----------LGLIWKIPATAIGI 99
                    +G+I  +  + IGI
Sbjct: 73 DAINSQTKWFMGIIVSVLVSTIGI 96

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target117 guanylate kinase [Candidatus Liberibacter asiaticus str
317120703123 hypothetical protein SC1_gp235 [Liberibacter phage SC1] 1 1e-61
31512178599 hypothetical protein CKC_00175 [Candidatus Liberibacter 1 0.003
>gi|317120703|gb|ADV02526.1| hypothetical protein SC1_gp235 [Liberibacter phage SC1] Length = 123 Back     alignment and organism information
 Score =  239 bits (609), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 117/117 (100%), Positives = 117/117 (100%)

Query: 1   MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN 60
           MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN
Sbjct: 7   MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN 66

Query: 61  REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF 117
           REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF
Sbjct: 67  REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF 123


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|315121785|ref|YP_004062274.1| hypothetical protein CKC_00175 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 99 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00