254781199

254781199

hypothetical protein CLIBASIA_05530

GeneID in NCBI database:8210224Locus tag:CLIBASIA_05530
Protein GI in NCBI database:254781199Protein Accession:YP_003065612.1
Gene range:-(1196268, 1196741)Protein Length:157aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccEHHHEEHcccccccEEEcHHHHHHHHHHHHEEEEEHHHHHHHHHHcccccccHHHHccHHHHHHHHHHHHHHHHHHHEEEcc
MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMakndsstqLDLAEIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVkegmfnsdpltllspFTQEIIACILGFWYTDKIVQKKK
MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKlemakndsstqlDLAEIKAGIeelkidkpirlARIEaqkvksgvkwvdGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK
MIQSflagglfrfllrfIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK
***SFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDK**************DLAEIKAGIEELKIDKPIRL*********SGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQK**
MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK
*IQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
oooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK
MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK
MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target157 hypothetical protein CLIBASIA_05530 [Candidatus Liberib
254780988151 hypothetical protein CLIBASIA_04445 [Candidatus Li 7e-42
>gi|254780988|ref|YP_003065401.1| hypothetical protein CLIBASIA_04445 [Candidatus Liberibacter asiaticus str. psy62] Length = 151 Back     alignment
 Score =  160 bits (406), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 114/158 (72%), Gaps = 15/158 (9%)

Query: 4   SFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIK 63
           SFL G + RF ++F+PS F    +++ EY+ K++SIE+D+L+LE+AK  S+TQ+DL  ++
Sbjct: 3   SFLTGSIARFFIKFVPSLF----NLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALE 58

Query: 64  AGIEELKIDKPIRLARIEAQ----KVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSV 119
           +       + P+RLAR++ Q    + +   K +  F ALIRP TT FWII+YPLL+WW V
Sbjct: 59  S-------ETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGV 111

Query: 120 KEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK 157
           ++G    DPLTLL+PFTQ+IIACILGFW+TD IVQ++K
Sbjct: 112 EKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRK 149

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target157 hypothetical protein CLIBASIA_05530 [Candidatus Liberib
317120748157 hypothetical protein SC2_gp250 [Liberibacter phage SC2] 1 2e-69
317120705158 hypothetical protein SC2_gp005 [Liberibacter phage SC2] 1 4e-69
315122886158 hypothetical protein CKC_05710 [Candidatus Liberibacter 1 7e-67
315121924158 hypothetical protein CKC_00870 [Candidatus Liberibacter 1 3e-66
315122344125 hypothetical protein CKC_02980 [Candidatus Liberibacter 1 4e-47
315122770124 hypothetical protein CKC_05125 [Candidatus Liberibacter 1 2e-45
315122566130 hypothetical protein CKC_04090 [Candidatus Liberibacter 1 9e-45
254780988151 hypothetical protein CLIBASIA_04445 [Candidatus Liberib 1 4e-38
315121790121 hypothetical protein CKC_00200 [Candidatus Liberibacter 1 4e-31
315122303115 hypothetical protein CKC_02775 [Candidatus Liberibacter 1 1e-30
>gi|317120748|gb|ADV02570.1| hypothetical protein SC2_gp250 [Liberibacter phage SC2] Length = 157 Back     alignment and organism information
 Score =  265 bits (676), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/157 (80%), Positives = 142/157 (90%)

Query: 1   MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLA 60
           MIQSFLAGGLFRFLLRFIPS FERIVDVVSEYLTKKQSIEYDK KLE AK DSS QLDLA
Sbjct: 1   MIQSFLAGGLFRFLLRFIPSSFERIVDVVSEYLTKKQSIEYDKWKLETAKIDSSLQLDLA 60

Query: 61  EIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVK 120
           +IK GIEELK DKPI+LARI+AQ +KSGVKW+D F  L+RPLTT FWIIVYP++VWWSVK
Sbjct: 61  DIKYGIEELKADKPIKLARIKAQNIKSGVKWIDSFNTLVRPLTTLFWIIVYPMMVWWSVK 120

Query: 121 EGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK 157
           EG+F+  PL++LSPF QEIIACILGFW+TDKIVQK++
Sbjct: 121 EGIFDKSPLSILSPFEQEIIACILGFWFTDKIVQKRR 157


Species: Liberibacter phage SC2
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|317120705|gb|ADV02527.1| hypothetical protein SC2_gp005 [Liberibacter phage SC2] Length = 158 Back     alignment and organism information
>gi|315122886|ref|YP_004063375.1| hypothetical protein CKC_05710 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 158 Back     alignment and organism information
>gi|315121924|ref|YP_004062413.1| hypothetical protein CKC_00870 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 158 Back     alignment and organism information
>gi|315122344|ref|YP_004062833.1| hypothetical protein CKC_02980 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 125 Back     alignment and organism information
>gi|315122770|ref|YP_004063259.1| hypothetical protein CKC_05125 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 124 Back     alignment and organism information
>gi|315122566|ref|YP_004063055.1| hypothetical protein CKC_04090 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 130 Back     alignment and organism information
>gi|254780988|ref|YP_003065401.1| hypothetical protein CLIBASIA_04445 [Candidatus Liberibacter asiaticus str. psy62] Length = 151 Back     alignment and organism information
>gi|315121790|ref|YP_004062279.1| hypothetical protein CKC_00200 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 121 Back     alignment and organism information
>gi|315122303|ref|YP_004062792.1| hypothetical protein CKC_02775 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 115 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 157 hypothetical protein CLIBASIA_05530 [Candidatus Liberib
pfam11351123 DUF3154 Protein of unknown function (DUF3154). This fam 97.16
>pfam11351 DUF3154 Protein of unknown function (DUF3154) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target157 hypothetical protein CLIBASIA_05530 [Candidatus Liberib
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 1e-04
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 41.1 bits (95), Expect = 1e-04
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 7/35 (20%)

Query: 35 KKQSIEYDKLK--LEMAKNDSSTQLDLAEIKAGIE 67
          +KQ+++  KL+  L++  +DS+    LA IKA +E
Sbjct: 18 EKQALK--KLQASLKLYADDSAPA--LA-IKATME 47


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00