254781213

254781213

head-to-tail joining protein, putative

GeneID in NCBI database:8210238Locus tag:CLIBASIA_05600
Protein GI in NCBI database:254781213Protein Accession:YP_003065626.1
Gene range:-(1214189, 1215859)Protein Length:556aa
Gene description:head-to-tail joining protein, putative
COG prediction:none
KEGG prediction:head-to-tail joining protein, putative
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550------
MNQRSAKDIQDRFNYLKNQRGELNYWMEELTGFLYPYKNNAQLRMWDTTGSEACIKLSSLLSSLITPPGQKWHGLAESFSAYQAFLYKEDARSKKVREWCDQVTDTLFGFRERSRSGFVGCLQSFYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVYMSVNHQNVVDSVYREFTFTVDQIVSKWGDKVLSSKMKSALARNENERFTIIHAVYPKSLTDKKKDKGNKGFHSKFVSVDENRFFEEKQIATFPYIVGRYRVRADEIYGRSPAMEALPTIRRLNETVNELAQFGRLSLHPPTIAVSEAKQRNFDLKPGYMNIGALSREGRSLFQPVQFGNPLPYHEELNRLKESIRSLFLLDLFQVLDDKASRSAAESMEKTREKGAFVGPLIGGLQSEFIGAMISRELDILDSQGNLPECEGADNPPVSLLKVEYTSPLFKYQQAESVASALQGVNTVVELGVKTGDPSCMDHMDTDRVSRFSLWATNTPAVLIRDTAEVEDIRQQREVQRRVMEEQHLQQQLQQTSQDIGAKAAGRAMEKKLTHDMMENSYG
ccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEEEEcccccccHHccccccEEEEEEccccEEEEEcccEEccEEEHHHEEccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEcccEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHccccHHHHHHHHHHHHHcccccccccHcEcccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccEEEccccccccccccEEEEEEcccccEEEEEcccccEEEEEEEEcccHHHHHHHHccccccHHHHHHHHcccccccEEEEEEEEccccccccccccccEEEEEEEccccEEEEccccccccEEcEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEccccccccccEEccccEEEEEccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEcHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccc
mnqrsakdIQDRFNYLKNQRGELNYWMEELTGFlypyknnaqlrmwdttGSEACIKLSSLLSslitppgqkwhglAESFSAYQAFLYKEDARSKKVREWCDQVTDTLFGfrersrsgfvgcLQSFYTSVVEfgtgcfymeadvdekglEEGIRYISVPLSNVYMSVNHQNVVDSVYREFTFTVDQIVSKWGDKVLSSKMKSALARNENERFTIIhavypksltdkkkdkgnkgfhskfvsvdenrffeekqiatfpyIVGRYRvradeiygrspamealPTIRRLNETVNELAQfgrlslhpptiavseakqrnfdlkpgymnigalsregrslfqpvqfgnplpyhEELNRLKESIRSLFLLDLFQVLDDKASRSAAESMEKTRekgafvgpligglqSEFIGAMISRELDIldsqgnlpecegadnppvsllkveytsplfkyqQAESVASALQGVNTVVELGvktgdpscmdhmdtdrvsrfslwatntpavlirdtAEVEDIRQQREVQRRVMEEQHLQQQLQQTSQDIGAKAAGRAMEKKLTHDMMENSYG
mnqrsakdiqdrFNYLKNQRGELNYWMEELTGFLYPYKNNAQLRMWDTTGSEACIKLSSLLSSLITPPGQKWHGLAESFSAYQAFLYKEDARSKKVREWCDQVTDTlfgfrersrsgFVGCLQSFYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVYMSVNHQNVVDSVYREFTFTVDQIVSKWGDKVLSSKMKSAlarnenerftiihavypksltdkkkdkgnkgfhskfvsvdenrffeekqiatfpyivgryrvRADEIYGRSPAMEALPTIRRLNETVNELAQFGRLSLHPPTIAVSEAKQRNFDLKPGYMNIGALSREGRSLFQPVQFGNPLPYHEELNRLKESIRSLFLLDLFQVLDDKASRSAAESMektrekgafvgplIGGLQSEFIGAMISRELDILDSQGNLPECEGADNPPVSLLKVEYTSPLFKYQQAESVASALQGVNTVVELGVKTGDPSCMDHMDTDRVSRfslwatntpavlirdtaevEDIRQQREVQRRVMEEQHLQQQLQQTSQDIGAKAAGRAMEKKLTHDMMENSYG
MNQRSAKDIQDRFNYLKNQRGELNYWMEELTGFLYPYKNNAQLRMWDTTGSEACIKlssllsslITPPGQKWHGLAESFSAYQAFLYKEDARSKKVREWCDQVTDTLFGFRERSRSGFVGCLQSFYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVYMSVNHQNVVDSVYREFTFTVDQIVSKWGDKVLSSKMKSALARNENERFTIIHAVYPKSLTDKKKDKGNKGFHSKFVSVDENRFFEEKQIATFPYIVGRYRVRADEIYGRSPAMEALPTIRRLNETVNELAQFGRLSLHPPTIAVSEAKQRNFDLKPGYMNIGALSREGRSLFQPVQFGNPLPYHEELNRLKESIRSlflldlfqvlddKASRSAAESMEKTREKGAFVGPLIGGLQSEFIGAMISRELDILDSQGNLPECEGADNPPVSLLKVEYTSPLFKYQQAESVASALQGVNTVVELGVKTGDPSCMDHMDTDRVSRFSLWATNTPAVLIRDTAevedirqqrevqrrvmeeqhlqqqlqqTSQDIGAKAAGRAMEKKLTHDMMENSYG
***********RFNYLKNQRGELNYWMEELTGFLYPYKNNAQLRMWDTTGSEACIKLSSLLSSLITPPGQKWHGLAESFS****************REWCDQVTDTLFGFRERSRSGFVGCLQSFYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVYMSVNHQNVVDSVYREFTFTVDQIVSKWGDKV**************ERFTIIHAVYPKSLTDKKKDKGNKGFHSKFVSVDENRFFEEKQIATFPYIVGRYRVRADEIYGRSPAMEALPTIRRLNETVNELAQFGRLSLHPPTIAVSEAKQRNFDLKPGYMNIGALSREGRSLFQPVQFGNPLPYHEELNRLKESIRSLFLLDLF*************SMEKTRE**AFVGPLIGGLQSEFIGAMISRELDILDSQGNLPECEGADNPPVSLLKVEYTSPLFK*******ASALQGVNTVVELGVKTGDPSCMDHMDTDRVSRFSLWATNTPAVLIRDT********************************************************
********IQDRFNYLKNQRGELNYWMEELTGFLYPYKNNAQLRMWDTTGSEACIKLSSLLSSLITPPGQKWHGLAESFSAYQAFLYKEDARSKKVREWCDQVTDTLFGFRERSRSGFVGCLQSFYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVYMSVNHQNVVDSVYREFTFTVDQIVSKWGDKVLSSKMKSALARNENERFTIIHAVYPKSLTDKKKDKGNKGFHSKFVSVDENRFFEEKQIATFPYIVGRYRVRADEIYGRSPAMEALPTIRRLNETVNELAQFGRLSLHPPTIAVSEAKQRNFDLKPGYMNIGALSREGRSLFQPVQFGNPLPYHEELNRLKESIRSLFLLDLFQVLDDKA************EKGAFVGPLIGGLQSEFIGAMISRELDILDSQGNLPECEGADNPPVSLLKVEYTSPLFKYQQAESVASALQGVNTVVELGVKTGDPSCMDHMDTDRVSRFSLWATNTPAVLIRDTAEVEDIRQQREVQR**************************AMEKKLTHDMMENSYG
MNQRSAKDIQDRFNYLKNQRGELNYWMEELTGFLYPYKNNAQLRMWDTTGSEACIKLSSLLSSLITPPGQKWHGLAESFSAYQAFLYKEDARSKKVREWCDQVTDTLFGFRERSRSGFVGCLQSFYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVYMSVNHQNVVDSVYREFTFTVDQIVSKWGDKVLSSKMKSALARNENERFTIIHAVYPKSLTDKKKDKGNKGFHSKFVSVDENRFFEEKQIATFPYIVGRYRVRADEIYGRSPAMEALPTIRRLNETVNELAQFGRLSLHPPTIAVSEAKQRNFDLKPGYMNIGALSREGRSLFQPVQFGNPLPYHEELNRLKESIRSLFLLDLFQVLDDKASRSAAESMEKTREKGAFVGPLIGGLQSEFIGAMISRELDILDSQGNLPECEGADNPPVSLLKVEYTSPLFKYQQAESVASALQGVNTVVELGVKTGDPSCMDHMDTDRVSRFSLWATNTPAVLIRDTAEVEDIRQQREVQRRVMEEQHLQQQLQQTSQDIGAKAAGR****KL**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQRSAKDIQDRFNYLKNQRGELNYWMEELTGFLYPYKNNAQLRMWDTTGSEACIKLSSLLSSLITPPGQKWHGLAESFSAYQAFLYKEDARSKKVREWCDQVTDTLFGFRERSRSGFVGCLQSFYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVYMSVNHQNVVDSVYREFTFTVDQIVSKWGDKVLSSKMKSALARNENERFTIIHAVYPKSLTDKKKDKGNKGFHSKFVSVDENRFFEEKQIATFPYIVGRYRVRADEIYGRSPAMEALPTIRRLNETVNELAQFGRLSLHPPTIAVSEAKQRNFDLKPGYMNIGALSREGRSLFQPVQFGNPLPYHEELNRLKESIRSLFLLDLFQVLDDKASRSAAESMEKTREKGAFVGPLIGGLQSEFIGAMISRELDILDSQGNLPECEGADNPPVSLLKVEYTSPLFKYQQAESVASALQGVNTVVELGVKTGDPSCMDHMDTDRVSRFSLWATNTPAVLIRDTAEVEDIRQQREVQRRVMEEQHLQQQLQQTSQDIGAKAAGRAMEKKLTHDMMENSYG
MNQRSAKDIQDRFNYLKNQRGELNYWMEELTGFLYPYKNNAQLRMWDTTGSEACIKLSSLLSSLITPPGQKWHGLAESFSAYQAFLYKEDARSKKVREWCDQVTDTLFGFRERSRSGFVGCLQSFYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVYMSVNHQNVVDSVYREFTFTVDQIVSKWGDKVLSSKMKSALARNENERFTIIHAVYPKSLTDKKKDKGNKGFHSKFVSVDENRFFEEKQIATFPYIVGRYRVRADEIYGRSPAMEALPTIRRLNETVNELAQFGRLSLHPPTIAVSEAKQRNFDLKPGYMNIGALSREGRSLFQPVQFGNPLPYHEELNRLKESIRSLFLLDLFQVLDDKASRSAAESMEKTREKGAFVGPLIGGLQSEFIGAMISRELDILDSQGNLPECEGADNPPVSLLKVEYTSPLFKYQQAESVASALQGVNTVVELGVKTGDPSCMDHMDTDRVSRFSLWATNTPAVLIRDTAEVEDIRQQREVQRRVMEEQHLQQQLQQTSQDIGAKAAGRAMEKKLTHDMMENSYG
MNQRSAKDIQDRFNYLKNQRGELNYWMEELTGFLYPYKNNAQLRMWDTTGSEACIKLSSLLSSLITPPGQKWHGLAESFSAYQAFLYKEDARSKKVREWCDQVTDTLFGFRERSRSGFVGCLQSFYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVYMSVNHQNVVDSVYREFTFTVDQIVSKWGDKVLSSKMKSALARNENERFTIIHAVYPKSLTDKKKDKGNKGFHSKFVSVDENRFFEEKQIATFPYIVGRYRVRADEIYGRSPAMEALPTIRRLNETVNELAQFGRLSLHPPTIAVSEAKQRNFDLKPGYMNIGALSREGRSLFQPVQFGNPLPYHEELNRLKESIRSLFLLDLFQVLDDKASRSAAESMEKTREKGAFVGPLIGGLQSEFIGAMISRELDILDSQGNLPECEGADNPPVSLLKVEYTSPLFKYQQAESVASALQGVNTVVELGVKTGDPSCMDHMDTDRVSRFSLWATNTPAVLIRDTAEVEDIRQQREVQRRVMEEQHLQQQLQQTSQDIGAKAAGRAMEKKLTHDMMENSYG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target556 head-to-tail joining protein, putative [Candidatus Libe
315121938555 head-to-tail joining protein, putative [Candidatus Libe 1 0.0
315122900555 head-to-tail joining protein, putative [Candidatus Libe 1 0.0
317120721539 putative phage-related head-to-tail joining protein [Li 1 1e-102
262043663554 hypothetical protein HMPREF0484_3791 [Klebsiella pneumo 1 1e-54
48697195549 hypothetical protein BcepC6B_gp05 [Burkholderia phage B 1 4e-53
221213955549 conserved hypothetical protein [Burkholderia multivoran 1 4e-52
221201497549 conserved hypothetical protein [Burkholderia multivoran 1 6e-52
242279813555 hypothetical protein Desal_2347 [Desulfovibrio salexige 1 7e-44
42526662560 head-to-tail joining protein, putative [Treponema denti 1 3e-36
291334411467 hypothetical protein ALOHA_HF400048F7ctg1g11 [unculture 1 2e-35
>gi|315121938|ref|YP_004062427.1| head-to-tail joining protein, putative [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 555 Back     alignment and organism information
 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/551 (72%), Positives = 455/551 (82%)

Query: 5   SAKDIQDRFNYLKNQRGELNYWMEELTGFLYPYKNNAQLRMWDTTGSEACIKLSSLLSSL 64
           S K I+  F +LK+QR ELN  MEELT  LYPYK   + RMWDTTGSEACIKLSSLLSSL
Sbjct: 4   SIKKIKTCFEHLKSQREELNTRMEELTSLLYPYKQEPKSRMWDTTGSEACIKLSSLLSSL 63

Query: 65  ITPPGQKWHGLAESFSAYQAFLYKEDARSKKVREWCDQVTDTLFGFRERSRSGFVGCLQS 124
           ITPPGQKWHGL+E F  +QAFLY+EDA +KK+R WCDQVTD LFGFRERSRSGFV CLQS
Sbjct: 64  ITPPGQKWHGLSEPFFRHQAFLYEEDAGAKKIRGWCDQVTDVLFGFRERSRSGFVSCLQS 123

Query: 125 FYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVYMSVNHQNVVDSVYREFTFTVD 184
           FYTS+VEFGTGCFY+EADVDE GLEEGIRYI+VPL++VY+SVNHQN VDS+YR F FT +
Sbjct: 124 FYTSIVEFGTGCFYIEADVDETGLEEGIRYIAVPLADVYLSVNHQNEVDSIYRTFEFTAE 183

Query: 185 QIVSKWGDKVLSSKMKSALARNENERFTIIHAVYPKSLTDKKKDKGNKGFHSKFVSVDEN 244
           QI  KWG KVLS KMKS+  + E ++F IIHAVYPKSL +KKKDKGNK FHSKFV +DEN
Sbjct: 184 QIGGKWGYKVLSDKMKSSYEKKEPDKFKIIHAVYPKSLAEKKKDKGNKNFHSKFVCIDEN 243

Query: 245 RFFEEKQIATFPYIVGRYRVRADEIYGRSPAMEALPTIRRLNETVNELAQFGRLSLHPPT 304
            FFEEKQI T PYI+GRYRVRADEIYG+SPAMEALP IRRLNE  NELAQ+ RLSLHP  
Sbjct: 244 VFFEEKQITTLPYIIGRYRVRADEIYGKSPAMEALPAIRRLNEISNELAQYARLSLHPAY 303

Query: 305 IAVSEAKQRNFDLKPGYMNIGALSREGRSLFQPVQFGNPLPYHEELNRLKESIRSLFLLD 364
           +A  EAKQ  F  K  YMNIGA+S++G++LFQP+Q GNPLP++EEL R++ SI SLFLLD
Sbjct: 304 LAPPEAKQLEFKNKSRYMNIGAMSKDGKALFQPLQVGNPLPFYEELKRIQGSIHSLFLLD 363

Query: 365 LFQVLDDKASRSAAESMEKTREKGAFVGPLIGGLQSEFIGAMISRELDILDSQGNLPECE 424
           LFQVLDDKASRSAAESMEKTREKGAFVGPLIGGLQSEFIGAMI RELDILD+Q NLPE  
Sbjct: 364 LFQVLDDKASRSAAESMEKTREKGAFVGPLIGGLQSEFIGAMIKRELDILDAQHNLPELT 423

Query: 425 GADNPPVSLLKVEYTSPLFKYQQAESVASALQGVNTVVELGVKTGDPSCMDHMDTDRVSR 484
             D+ P  LLKVEYTSPLFKYQQAESVAS LQG NTV+ELG KTG+P  MDH+D D+VSR
Sbjct: 424 DYDHSPFHLLKVEYTSPLFKYQQAESVASVLQGTNTVLELGAKTGNPEPMDHIDIDKVSR 483

Query: 485 FSLWATNTPAVLIRDTAEVEDIRQQREVQRRVMEEQHLQQQLQQTSQDIGAKAAGRAMEK 544
           F+LWA+ +PA LIRD  EV+  R+ R+ Q   M+ +   QQ +Q   + GAKA  +A+EK
Sbjct: 484 FALWASGSPAHLIRDVDEVKQRRKDRDDQMEAMQNRQDAQQQEQMGMEAGAKAVSKAIEK 543

Query: 545 KLTHDMMENSY 555
           K+T+D+MENSY
Sbjct: 544 KMTNDLMENSY 554


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122900|ref|YP_004063389.1| head-to-tail joining protein, putative [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 555 Back     alignment and organism information
>gi|317120721|gb|ADV02543.1| putative phage-related head-to-tail joining protein [Liberibacter phage SC2] Length = 539 Back     alignment and organism information
>gi|262043663|ref|ZP_06016772.1| hypothetical protein HMPREF0484_3791 [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length = 554 Back     alignment and organism information
>gi|48697195|ref|YP_024925.1| hypothetical protein BcepC6B_gp05 [Burkholderia phage BcepC6B] Length = 549 Back     alignment and organism information
>gi|221213955|ref|ZP_03586928.1| conserved hypothetical protein [Burkholderia multivorans CGD1] Length = 549 Back     alignment and organism information
>gi|221201497|ref|ZP_03574536.1| conserved hypothetical protein [Burkholderia multivorans CGD2M] Length = 549 Back     alignment and organism information
>gi|242279813|ref|YP_002991942.1| hypothetical protein Desal_2347 [Desulfovibrio salexigens DSM 2638] Length = 555 Back     alignment and organism information
>gi|42526662|ref|NP_971760.1| head-to-tail joining protein, putative [Treponema denticola ATCC 35405] Length = 560 Back     alignment and organism information
>gi|291334411|gb|ADD94066.1| hypothetical protein ALOHA_HF400048F7ctg1g11 [uncultured phage MedDCM-OCT-S04-C1035] Length = 467 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target556 head-to-tail joining protein, putative [Candidatus Libe
pfam12236480 pfam12236, Head-tail_con, Bacteriophage head to tail co 1e-58
PHA00670540 PHA00670, PHA00670, hypothetical protein 3e-64
>gnl|CDD|152671 pfam12236, Head-tail_con, Bacteriophage head to tail connecting protein Back     alignment and domain information
>gnl|CDD|106978 PHA00670, PHA00670, hypothetical protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 556 head-to-tail joining protein, putative [Candidatus Libe
PHA00670540 hypothetical protein 100.0
pfam12236480 Head-tail_con Bacteriophage head to tail connecting pro 100.0
pfam05133435 Phage_prot_Gp6 Phage portal protein, SPP1 Gp6-like. Thi 97.28
pfam05126473 consensus 95.46
PHA00670540 hypothetical protein 95.05
>PHA00670 hypothetical protein Back     alignment and domain information
>pfam12236 Head-tail_con Bacteriophage head to tail connecting protein Back     alignment and domain information
>pfam05133 Phage_prot_Gp6 Phage portal protein, SPP1 Gp6-like Back     alignment and domain information
>pfam05126 consensus Back     alignment and domain information
>PHA00670 hypothetical protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target556 head-to-tail joining protein, putative [Candidatus Libe
2jes_A503 Portal protein; DNA translocation, molecular motor, vir 98.18
>2jes_A Portal protein; DNA translocation, molecular motor, viral portal protein, viral protein; 3.4A {Bacteriophage SPP1} Back     alignment and structure
Probab=98.18  E-value=0.00038  Score=44.08  Aligned_cols=310  Identities=8%  Similarity=-0.037  Sum_probs=160.5

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             77752542799999999998764188788760111081144442023223348999999999999998750231473889
Q gi|254781213|r   42 QLRMWDTTGSEACIKLSSLLSSLITPPGQKWHGLAESFSAYQAFLYKEDARSKKVREWCDQVTDTLFGFRERSRSGFVGC  121 (556)
Q Consensus        42 ~~~i~dst~~~a~~~lAs~L~~~ltPp~~~WF~l~~~~~~~~~~~~~~~~~~~ev~~~L~~v~~~i~~~~~~~~snf~~~  121 (556)
                      +.||..+-+..-+++.++.|.+-  |+.     +...+              +++.+.|++       +  + ..+|...
T Consensus        81 nnri~~n~~~~ivd~~~~yl~G~--Pi~-----~~~~d--------------~~~~e~l~~-------~--~-~n~~~~~  129 (503)
T 2jes_A           81 NNRTSHAWHKLFVDQKTQYLVGE--PVT-----FTSDN--------------KTLLEYVNE-------L--A-DDDFDDI  129 (503)
T ss_dssp             CCCCCCTHHHHHHHHHHHHHTSS--CCE-----EECSC--------------HHHHHHHHH-------H--S-SSHHHHH
T ss_pred             CCEEECCHHHHHHHHCCCEEECC--CCE-----EECCC--------------HHHHHHHHH-------H--H-CCCHHHH
T ss_conf             63310666778776121267258--978-----85787--------------789999999-------9--7-4778999


Q ss_pred             HHHHHHHHHHHHHHHHEECCCCCCCCCCCCEEEEEEEHHHEEEEEC--CCCCEEEEEEEECCCHHHHHHHCCCCCCCHHH
Q ss_conf             9999999875410332221676665444660588865544666108--98887153200036977866631522357256
Q gi|254781213|r  122 LQSFYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVYMSVN--HQNVVDSVYREFTFTVDQIVSKWGDKVLSSKM  199 (556)
Q Consensus       122 ~~e~~~dL~~~Gta~l~i~~d~~~~~~~~~~rf~~~pl~~~~i~~d--~~G~vd~i~r~~~~t~~ql~~~fg~~~l~~~~  199 (556)
                      ..++.+++..+|.+.+++.-+.     .+-+++..+++.+++.-.|  ..+++..++|.+...-.          ..+..
T Consensus       130 ~~e~~~~~s~~G~~~~~~y~de-----~g~~~~~~i~p~~~~pv~dd~~~~~~~~~vr~y~~~~~----------~~~~~  194 (503)
T 2jes_A          130 LNETVKNMSNKGIEYWHPFVDE-----EGEFDYVIFPAEEMIVVYKDNTRRDILFALRYYSYKGI----------MGEET  194 (503)
T ss_dssp             HHHHHHHHHHHSEEEEEEEECT-----TSCEEEEEECTTTEEECC-----------------------------------
T ss_pred             HHHHHHHHHHCCCEEEEEEECC-----CCCEEEEEECCCCEEEEEECCCCCCEEEEEEEEEEECC----------CCCEE
T ss_conf             9999999974371999998889-----99789999886608999868987664699999988647----------88468


Q ss_pred             HHHHCCCCCCCEEEEEEEEECCCCCCCCCCCCCCEEEEEEECC-CCEEC---CCCCCCCCCEEEEEEEECCCCCCCHHHH
Q ss_conf             6541035557156668885357656554445321277654213-76451---0178665874555114148721020269
Q gi|254781213|r  200 KSALARNENERFTIIHAVYPKSLTDKKKDKGNKGFHSKFVSVD-ENRFF---EEKQIATFPYIVGRYRVRADEIYGRSPA  275 (556)
Q Consensus       200 ~~~~~~~~~~~~~v~~~v~pr~~~~~~~~~~~~~~~sv~~~~~-~~~vl---~e~g~~e~P~~~~Rw~~~~ge~YGrgp~  275 (556)
                         ..-.-+....+.+.+.......     ..    ..+.... ..++.   ..-+|...|++.++     ++.+|.|-.
T Consensus       195 ---~~~e~yt~~~i~~~~~~~~~~~-----~~----~~~~~~~~~~~~~~~~~~~~~~~vPii~~~-----nn~~g~sd~  257 (503)
T 2jes_A          195 ---QKAELYTDTHVYYYEKIDGVYQ-----MD----YSYGENNPRPHMTKGGQAIGWGRVPIIPFK-----NNEEMVSDL  257 (503)
T ss_dssp             --------------------------------------------------------CCSCSCEEEE-----SSSSCCCGG
T ss_pred             ---EEEEEEECCEEEEEEECCCCEE-----CC----CCCCCCCCCCCEECCCCCCCCCCCCEEEEE-----CCCCCCCHH
T ss_conf             ---9999998988999995698422-----03----444556777621025411346875669974-----687786606


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCC----CEECCCCCCCCCCCCCCCCCCCCCCCC-CHHHHHHHH
Q ss_conf             975889999999999999999975198689327863043----100247643324588765542200012-202699999
Q gi|254781213|r  276 MEALPTIRRLNETVNELAQFGRLSLHPPTIAVSEAKQRN----FDLKPGYMNIGALSREGRSLFQPVQFG-NPLPYHEEL  350 (556)
Q Consensus       276 ~~aL~D~k~Ln~l~~~~l~~~~~~~~p~~~v~~~~~~~~----~~l~pg~~~~~~~~~~~~~~~~p~~~g-~~~~~~~~i  350 (556)
                      +...+-+..+|.+.=..+...+...+|.+.+...+....    .++......... .+++   +..+... +.......+
T Consensus       258 e~v~~LiDa~d~~~S~~~n~~~~~~~~ilv~~g~~~~~~~~~~~~~~~~~~~~~~-~~~~---~~~l~~~~~~~~~~~~~  333 (503)
T 2jes_A          258 KFYKDLIDNYDSITSSTMDSFSDFQQIVYVLKNYDGENPKEFTANLRYHSVIKVS-GDGG---VDTLRAEIPVDSAAKEL  333 (503)
T ss_dssp             GGTHHHHHHHHHHHHHHHHHHHHTTSCEEEEEEESCSCHHHHHHHHHHSSEEEEE-EEEE---EEEECCCCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCC-CCCC---CEEEEECCCHHHHHHHH
T ss_conf             5229999999998707889999876146430477776606577776632441358-9998---05886158848999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             999999999742221013246667777999999999999977888778878999999999999987399
Q gi|254781213|r  351 NRLKESIRSLFLLDLFQVLDDKASRSAAESMEKTREKGAFVGPLIGGLQSEFIGAMISRELDILDSQGN  419 (556)
Q Consensus       351 ~~~~~~I~~~f~~d~~~~~~~~~~~TAtEv~~r~~e~~~~Lg~v~~rl~~E~l~Pli~r~~~il~r~g~  419 (556)
                      +.++..|-...+...+..-..+.+.|+..+..+...+.. ......+.-...|..++.-.+.++...+.
T Consensus       334 ~~L~~~I~~~s~~p~~~~~~~~gn~Sg~Aik~~~~~l~~-ka~~~e~~~~~~l~~~~~li~~~l~~~~~  401 (503)
T 2jes_A          334 ERIQDELYKSAQAVDNSPETIGGGATGPALEKLYALLDL-KANMAERKIRAGLRLFFWFFAEYLRNTGK  401 (503)
T ss_dssp             HHHHHHHHHHTTCCCCSCCSSTTTTSHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999999999839997785334677439999998747999-99999999999999999999999974167




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00