254781212

254781212

hypothetical protein CLIBASIA_05595

GeneID in NCBI database:8210237Locus tag:CLIBASIA_05595
Protein GI in NCBI database:254781212Protein Accession:YP_003065625.1
Gene range:-(1213867, 1214196)Protein Length:109aa
Gene description:hypothetical protein
COG prediction:[O] [U] Protease subunit of ATP-dependent Clp proteases
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MVNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY
cccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEHHHHHHccccHHccccccHHEEEEEccccEEEEEEEccccccHHHHHHHHcccccc
cccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcEcEEEccccccEEEEEHHHcccccccccccHHHHHHHHHccHHHHHHEHHcccccHHHHHHEccccccc
MVNFRKLADMIKSKVlsrgytvdsDALARQLEEDERRIRHYkhvystpegrfVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY
MVNFRKLADMIkskvlsrgytvdsdALARQLeederrirhykhvystpegrfVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQmysdnpry
MVNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY
***FRK*ADMIKSKVLSRGYTVDSDALARQLEE***RIRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMY******
MVNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY
*VNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDN***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY
MVNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY
MVNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target109 hypothetical protein CLIBASIA_05595 [Candidatus Liberib
315122899108 hypothetical protein CKC_05775 [Candidatus Liberibacter 1 3e-27
315121937104 hypothetical protein CKC_00935 [Candidatus Liberibacter 1 3e-24
31712072090 hypothetical protein SC2_gp100 [Liberibacter phage SC2] 1 1e-07
>gi|315122899|ref|YP_004063388.1| hypothetical protein CKC_05775 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 108 Back     alignment and organism information
 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 80/104 (76%)

Query: 1   MVNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVE 60
           M++F+ +A+ IK+  L RGYTVD   LA +LEEDE+R+R YK V++T  G+ VL DLMVE
Sbjct: 1   MIDFKAIAEKIKNTALGRGYTVDPVVLAERLEEDEKRLRLYKSVFATEAGKEVLIDLMVE 60

Query: 61  GGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYS 104
           GGLLSS   D A +LA  EGKR++AV IAS+ GL+FE+IVQMYS
Sbjct: 61  GGLLSSPEIDDALKLAHCEGKRAMAVRIASSLGLNFEQIVQMYS 104


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315121937|ref|YP_004062426.1| hypothetical protein CKC_00935 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 104 Back     alignment and organism information
>gi|317120720|gb|ADV02542.1| hypothetical protein SC2_gp100 [Liberibacter phage SC2] Length = 90 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00