254781217

254781217

hypothetical protein CLIBASIA_05620

GeneID in NCBI database:8210242Locus tag:CLIBASIA_05620
Protein GI in NCBI database:254781217Protein Accession:YP_003065630.1
Gene range:-(1218331, 1218819)Protein Length:162aa
Gene description:hypothetical protein
COG prediction:[L] Transposase and inactivated derivatives
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHTIDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD
cccHHHHHHHHHHHHHHHcccccHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccc
ccccHccHHHHHHHHHHcccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHcEEcccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEcccHHHHHHHHHHHHcccccHHHHHHccccccccccccccc
MYAHKYTKERIDNILASfsgglslsqsckkHGVTVVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLasvveaplteeerdhPQAIKLRELRMKRLQWELEKRYRNVYgnhvsveqkhtidlkplmDRVQHSiqskglkpvkaldkqtekplelpkltkhd
myahkytkeriDNILASFSGGLSLSQSCKKHGVTVVSfhgwvkqdrEDLEKRYEQAKQSHMEHLSENLASVVEaplteeerdhpqaiklrELRMKRLQWELEKRYRNVYGNHVSVEQKHTIDLKPLMDRVQHSIqskglkpvkaldkqtekplelpkltkhd
MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHTIDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD
****K*TKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPL*********AIKLRELRMKRLQWELEKRYRNVYGNHVSVE*****D***************************E*****P******
MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHTIDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD
*YAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSH*EH**ENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHTIDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPK*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDxxxxxxxxxxxxxxxxxxxxxNLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHTIDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD
MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHTIDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD
MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHTIDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target162 hypothetical protein CLIBASIA_05620 [Candidatus Liberib
254781188185 hypothetical protein CLIBASIA_05475 [Candidatus Li 6e-12
>gi|254781188|ref|YP_003065601.1| hypothetical protein CLIBASIA_05475 [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Back     alignment
 Score = 61.6 bits (148), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 83/155 (53%), Gaps = 10/155 (6%)

Query: 6   YTKERIDNILASFSGGLSLSQSCKKHGVTVVS-FHGWVKQDREDLEKRYEQAKQSHMEHL 64
           Y+ E    IL   + G +L    +K G+   S F+ W+K+D + L++ Y +A Q  ++ L
Sbjct: 21  YSPELFAGILDQVANGKALGHVLRKVGMPKYSTFYRWIKKDLK-LQEAYTEALQCRLDLL 79

Query: 65  SENLASVVEAPLTEEERDHPQAI-KLRELRMKRLQWELEKRYRNVYGNHVSVEQKHTIDL 123
           +E L        T EE  +P    K+R+ + +   + LEK     YG  VSVE KHTIDL
Sbjct: 80  AEELLEEPAP--TAEELANPVFYSKMRDRKQRMGTFLLEKLSNQKYGPRVSVESKHTIDL 137

Query: 124 KPLMDRVQHSIQSKGLKPV---KALDKQTEKPLEL 155
           +P ++R++     K LKP+   +   K TEKPLE+
Sbjct: 138 RPAIERLRE--HYKHLKPIDSERIPHKSTEKPLEI 170

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target162 hypothetical protein CLIBASIA_05620 [Candidatus Liberib
317120681171 hypothetical protein SC1_gp120 [Liberibacter phage SC1] 1 3e-90
315121941172 hypothetical protein CKC_00955 [Candidatus Liberibacter 1 2e-47
315122903180 hypothetical protein CKC_05795 [Candidatus Liberibacter 1 2e-12
254781188185 hypothetical protein CLIBASIA_05475 [Candidatus Liberib 1 3e-08
254497230157 putative phage associated protein [Legionella drancourt 2 3e-09
126443704147 hypothetical protein BURPS668_A2355 [Burkholderia pseud 2 3e-09
254240164188 hypothetical protein PA2G_00805 [Pseudomonas aeruginosa 2 5e-09
156934896150 hypothetical protein ESA_02744 [Cronobacter sakazakii A 2 3e-08
325497785141 putative terminase small subunit [Escherichia fergusoni 2 4e-08
260596961164 hypothetical protein CTU_11690 [Cronobacter turicensis 2 9e-08
>gi|317120681|gb|ADV02504.1| hypothetical protein SC1_gp120 [Liberibacter phage SC1] Length = 171 Back     alignment and organism information
 Score =  334 bits (856), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 162/162 (100%), Positives = 162/162 (100%)

Query: 1   MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSH 60
           MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSH
Sbjct: 10  MYAHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQDREDLEKRYEQAKQSH 69

Query: 61  MEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHT 120
           MEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHT
Sbjct: 70  MEHLSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHT 129

Query: 121 IDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD 162
           IDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD
Sbjct: 130 IDLKPLMDRVQHSIQSKGLKPVKALDKQTEKPLELPKLTKHD 171


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|315121941|ref|YP_004062430.1| hypothetical protein CKC_00955 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 172 Back     alignment and organism information
>gi|315122903|ref|YP_004063392.1| hypothetical protein CKC_05795 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 180 Back     alignment and organism information
>gi|254781188|ref|YP_003065601.1| hypothetical protein CLIBASIA_05475 [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Back     alignment and organism information
>gi|254497230|ref|ZP_05110039.1| putative phage associated protein [Legionella drancourtii LLAP12] Length = 157 Back     alignment and organism information
>gi|126443704|ref|YP_001063349.1| hypothetical protein BURPS668_A2355 [Burkholderia pseudomallei 668] Length = 147 Back     alignment and organism information
>gi|254240164|ref|ZP_04933486.1| hypothetical protein PA2G_00805 [Pseudomonas aeruginosa 2192] Length = 188 Back     alignment and organism information
>gi|156934896|ref|YP_001438812.1| hypothetical protein ESA_02744 [Cronobacter sakazakii ATCC BAA-894] Length = 150 Back     alignment and organism information
>gi|325497785|gb|EGC95644.1| putative terminase small subunit [Escherichia fergusonii ECD227] Length = 141 Back     alignment and organism information
>gi|260596961|ref|YP_003209532.1| hypothetical protein CTU_11690 [Cronobacter turicensis z3032] Length = 164 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 162 hypothetical protein CLIBASIA_05620 [Candidatus Liberib
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and related 96.76
pfam0152775 Transposase_8 Transposase. Transposase proteins are nec 96.47
pfam0279645 HTH_7 Helix-turn-helix domain of resolvase. 95.83
pfam01710120 Transposase_14 Transposase. Transposase proteins are ne 95.29
pfam0421853 CENP-B_N CENP-B N-terminal DNA-binding domain. Centrome 94.55
COG2963116 Transposase and inactivated derivatives [DNA replicatio 93.25
COG3415138 Transposase and inactivated derivatives [DNA replicatio 93.07
pfam0522545 HTH_psq helix-turn-helix, Psq domain. This DNA-binding 92.94
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>pfam01527 Transposase_8 Transposase Back     alignment and domain information
>pfam02796 HTH_7 Helix-turn-helix domain of resolvase Back     alignment and domain information
>pfam01710 Transposase_14 Transposase Back     alignment and domain information
>pfam04218 CENP-B_N CENP-B N-terminal DNA-binding domain Back     alignment and domain information
>COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam05225 HTH_psq helix-turn-helix, Psq domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target162 hypothetical protein CLIBASIA_05620 [Candidatus Liberib
3hef_A143 Crystal Structure Of The Bacteriophage Sf6 Terminas 8e-21
>gi|288562970|pdb|3HEF|A Chain A, Crystal Structure Of The Bacteriophage Sf6 Terminase Small Subunit Length = 143 Back     alignment and structure
 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 25/112 (22%), Positives = 49/112 (43%), Gaps = 7/112 (6%)

Query: 6   YTKERIDNILASFSGGLSLSQSCKKHGVT-VVSFHGWVKQDREDLEKRYEQAKQSHMEHL 64
           Y  E  D+I +  S G SL + CK+ G+    +   W+ +  ED   +Y +A ++  + +
Sbjct: 16  YMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKH-EDFRDKYAKATEARADSI 74

Query: 65  SENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVE 116
            E +  + +  +          +    LR+   +W L +     YG+ V+ E
Sbjct: 75  FEEIFEIADNAIP-----DAAEVAKARLRVDTRKWALARMNPRKYGDKVTNE 121


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target162 hypothetical protein CLIBASIA_05620 [Candidatus Liberib
3hef_A143 Gene 1 protein; bacteriophage SF6, terminase small subu 2e-11
>3hef_A Gene 1 protein; bacteriophage SF6, terminase small subunit GP1, GP1 octameric assembly, GP1 channel, DNA recognition, DNA packaging; 1.65A {Enterobacteria phage SF6} Length = 143 Back     alignment and structure
 Score = 63.8 bits (155), Expect = 2e-11
 Identities = 26/115 (22%), Positives = 50/115 (43%), Gaps = 7/115 (6%)

Query: 5   KYTKERIDNILASFSGGLSLSQSCKKHGVTVVS-FHGWVKQDREDLEKRYEQAKQSHMEH 63
            Y  E  D+I +  S G SL + CK+ G+   S    W+ +  ED   +Y +A ++  + 
Sbjct: 15  DYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKH-EDFRDKYAKATEARADS 73

Query: 64  LSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQK 118
           + E +  + +  + +        +    LR+   +W L +     YG+ V+ E  
Sbjct: 74  IFEEIFEIADNAIPDAA-----EVAKARLRVDTRKWALARMNPRKYGDKVTNELV 123


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target162 hypothetical protein CLIBASIA_05620 [Candidatus Liberib
3hef_A143 Gene 1 protein; bacteriophage SF6, terminase small subu 99.94
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated reco 96.69
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, nati 96.61
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein struct 96.45
2rn7_A108 IS629 ORFA; helix, all alpha, unknown function, structu 95.15
1u78_A141 TC3 transposase, transposable element TC3 transposase; 94.44
2r0q_C209 Putative transposon TN552 DNA-invertase BIN3; site-spec 94.44
1k78_A149 Paired box protein PAX5; paired domain, ETS domain, tra 93.95
2k27_A159 Paired box protein PAX-8; paired domain, solution struc 93.13
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn-heli 92.18
>3hef_A Gene 1 protein; bacteriophage SF6, terminase small subunit GP1, GP1 octameric assembly, GP1 channel, DNA recognition, DNA packaging; 1.65A {Enterobacteria phage SF6} Back     alignment and structure
Probab=99.94  E-value=2.8e-26  Score=192.75  Aligned_cols=113  Identities=22%  Similarity=0.459  Sum_probs=104.0

Q ss_pred             HHCCHHHHHHHHHHHHCCHHHHHHHHCCCCC-HHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCC
Q ss_conf             2429999999999974895799997217999-789999998481999999999999979999999998652026324204
Q gi|254781217|r    4 HKYTKERIDNILASFSGGLSLSQSCKKHGVT-VVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERD   82 (162)
Q Consensus         4 ~Kyt~el~d~Ic~~Ia~G~SLr~Ick~~gmp-~~Tv~~Wl~kd~eef~e~Y~~Ar~~~ad~ladEileIad~~~~~~~~~   82 (162)
                      .|||+++++.||++|++|.|++.||++.||| ++|||+|+.++ ++|+++|.+||+.+++.++|++++|++.+..     
T Consensus        14 tk~t~e~~e~I~~~l~~G~sl~~i~~~~gvps~sT~~~Wl~~~-~ef~e~y~~Ar~~~~~~~~~~~~~i~~~~~~-----   87 (143)
T 3hef_A           14 SDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKH-EDFRDKYAKATEARADSIFEEIFEIADNAIP-----   87 (143)
T ss_dssp             CSCCHHHHHHHHHHHHTTCCHHHHHTSTTCCCHHHHHHHTTTC-HHHHHHHHHHHHHHHHHHHHHHHHHHHTCCS-----
T ss_pred             CCCCHHHHHHHHHHHHCCCCHHHHHHCCCCCCHHHHHHHHHHC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-----
T ss_conf             6579999999999998898599998707999689999999718-9999999999999999999999999861024-----


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCHHHHCCHHHHHHHCCHH
Q ss_conf             9899999999999999999875644401112334421025
Q gi|254781217|r   83 HPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHTID  122 (162)
Q Consensus        83 ~~~~i~~~rl~id~~kW~asKl~Pk~YGdKv~vE~~~t~~  122 (162)
                      +...++.+|+++++++|+|+||+|++||||+++|+++...
T Consensus        88 ~~~~~~~~r~~~~~~kw~l~kl~P~~ygdk~~~e~~g~~~  127 (143)
T 3hef_A           88 DAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDG  127 (143)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHSHHHHSCCEEEEEECGGG
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
T ss_conf             6188888688899999999766830136564310367899



>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>2r0q_C Putative transposon TN552 DNA-invertase BIN3; site-specific recombinase, resolvase, DNA-binding protein, protein-DNA complex, DNA integration, DNA invertase, DNA recombination; 3.20A {Staphylococcus aureus} Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target162 hypothetical protein CLIBASIA_05620 [Candidatus Liberib
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 96.9
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium glutam 96.52
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melanogaste 94.57
d1k78a163 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 93.99
d1hlva166 DNA-binding domain of centromere binding protein B (CEN 92.61
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Recombinase DNA-binding domain
domain: HIN recombinase (DNA-binding domain)
species: Synthetic
Probab=96.90  E-value=0.0003  Score=46.08  Aligned_cols=42  Identities=14%  Similarity=0.166  Sum_probs=39.1

Q ss_pred             CHHCCHHHHHHHHHHHHCCHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             124299999999999748957999972179997899999984
Q gi|254781217|r    3 AHKYTKERIDNILASFSGGLSLSQSCKKHGVTVVSFHGWVKQ   44 (162)
Q Consensus         3 ~~Kyt~el~d~Ic~~Ia~G~SLr~Ick~~gmp~~Tv~~Wl~k   44 (162)
                      -+++|++.++.+-.++++|.|...||+..|++..|+|+|+-.
T Consensus         3 ~~~lt~~q~~~a~~l~~~G~s~~~iA~~~gVSr~TiYry~pa   44 (47)
T d1ijwc_           3 PRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPA   44 (47)
T ss_dssp             CCSSCHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHSCS
T ss_pred             CCCCCHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHCCC
T ss_conf             885999999999999988997999999979699999855775



>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 162 hypothetical protein CLIBASIA_05620 [Candidatus Li
3hef_A_143 (A:) Gene 1 protein; bacteriophage SF6, terminase 3e-10
>3hef_A (A:) Gene 1 protein; bacteriophage SF6, terminase small subunit GP1, GP1 octameric assembly, GP1 channel, DNA recognition, DNA packaging; 1.65A {Enterobacteria phage SF6}Length = 143 Back     alignment and structure
 Score = 59.1 bits (143), Expect = 3e-10
 Identities = 27/131 (20%), Positives = 54/131 (41%), Gaps = 13/131 (9%)

Query: 5   KYTKERIDNILASFSGGLSLSQSCKKHGV-TVVSFHGWVKQDREDLEKRYEQAKQSHMEH 63
            Y  E  D+I +  S G SL + CK+ G+    +   W+ +  ED   +Y +A ++  + 
Sbjct: 15  DYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKH-EDFRDKYAKATEARADS 73

Query: 64  LSENLASVVEAPLTEEERDHPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKH---- 119
           + E +  + +  + +        +    LR+   +W L +     YG+ V+ E       
Sbjct: 74  IFEEIFEIADNAIPDAA-----EVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGG 128

Query: 120 --TIDLKPLMD 128
              I+  P+  
Sbjct: 129 AIQIETSPMST 139


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target162 hypothetical protein CLIBASIA_05620 [Candidatus Liberib
3hef_A_143 Gene 1 protein; bacteriophage SF6, terminase small 99.85
2elh_A_87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 97.21
1jko_C_52 HIN recombinase, DNA-invertase HIN; water-mediated 96.95
2jn6_A_1-5656 Protein CGL2762, transposase; GFT PSI-2, protein s 96.48
2rn7_A_108 IS629 ORFA; helix, all alpha, unknown function; NM 95.96
1pdn_C_17-6953 Protein (PRD paired); protein-DNA complex, double 95.26
2cob_A_70 LCOR protein; MLR2, KIAA1795, helix-turn-helix, st 95.18
1hlv_A_1-6767 CENP-B, major centromere autoantigen B; helix-turn 94.89
2k27_A_1-7575 Paired box protein PAX-8; paired domain, solution 93.35
2r0q_C_151-20959 Putative transposon TN552 DNA-invertase BIN3; site 91.92
>3hef_A (A:) Gene 1 protein; bacteriophage SF6, terminase small subunit GP1, GP1 octameric assembly, GP1 channel, DNA recognition, DNA packaging; 1.65A {Enterobacteria phage SF6} Back     alignment and structure
Probab=99.85  E-value=9.4e-21  Score=157.32  Aligned_cols=111  Identities=23%  Similarity=0.461  Sum_probs=103.2

Q ss_pred             HHCCHHHHHHHHHHHHCCHHHHHHHHCCCCC-HHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCC
Q ss_conf             2429999999999974895799997217999-789999998481999999999999979999999998652026324204
Q gi|254781217|r    4 HKYTKERIDNILASFSGGLSLSQSCKKHGVT-VVSFHGWVKQDREDLEKRYEQAKQSHMEHLSENLASVVEAPLTEEERD   82 (162)
Q Consensus         4 ~Kyt~el~d~Ic~~Ia~G~SLr~Ick~~gmp-~~Tv~~Wl~kd~eef~e~Y~~Ar~~~ad~ladEileIad~~~~~~~~~   82 (162)
                      .|||+++++.||+.+++|.|++.||+..||| ++||++|+.++ ++|+++|.+||+.+.+.+++.++++++..     .+
T Consensus        14 sky~~e~~~~i~~~~~~G~s~~~Ia~~~gips~~Tl~~W~~~~-~ef~e~~~~ak~~~~~~v~~~l~~~A~~~-----~~   87 (143)
T 3hef_A           14 SDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKH-EDFRDKYAKATEARADSIFEEIFEIADNA-----IP   87 (143)
T ss_dssp             CSCCHHHHHHHHHHHHTTCCHHHHHTSTTCCCHHHHHHHTTTC-HHHHHHHHHHHHHHHHHHHHHHHHHHHTC-----CS
T ss_pred             CCCCHHHHHHHHHHHHCCCCHHHHHHCCCCCCHHHHHHHHHHC-HHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CC
T ss_conf             7689999999999998798799998727999689999999817-89999999999999999999999999601-----13


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCHHHHCCHHHHHHHCC
Q ss_conf             98999999999999999998756444011123344210
Q gi|254781217|r   83 HPQAIKLRELRMKRLQWELEKRYRNVYGNHVSVEQKHT  120 (162)
Q Consensus        83 ~~~~i~~~rl~id~~kW~asKl~Pk~YGdKv~vE~~~t  120 (162)
                      +...+...+..+++++|+|+++.|++||||++||+++.
T Consensus        88 ~~~~~~~~~~~~~A~~f~L~~~~p~~y~dk~~~e~tg~  125 (143)
T 3hef_A           88 DAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGK  125 (143)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHSHHHHSCCEEEEEECG
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCCC
T ss_conf             52788777788889999997268131365432003578



>2elh_A (A:) CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>1jko_C (C:) HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} Back     alignment and structure
>2jn6_A (A:1-56) Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} Back     alignment and structure
>2rn7_A (A:) IS629 ORFA; helix, all alpha, unknown function; NMR {Shigella flexneri} Back     alignment and structure
>1pdn_C (C:17-69) Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} Back     alignment and structure
>2cob_A (A:) LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hlv_A (A:1-67) CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} Back     alignment and structure
>2k27_A (A:1-75) Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>2r0q_C (C:151-209) Putative transposon TN552 DNA-invertase BIN3; site-specific recombinase, resolvase, DNA-binding protein, protein-DNA complex, DNA integration, DNA invertase, DNA recombination; 3.20A {Staphylococcus aureus} Back     alignment and structure