254781218

254781218

hypothetical protein CLIBASIA_05625

GeneID in NCBI database:8210243Locus tag:CLIBASIA_05625
Protein GI in NCBI database:254781218Protein Accession:YP_003065631.1
Gene range:-(1219923, 1220540)Protein Length:205aa
Gene description:hypothetical protein
COG prediction:[K] Predicted transcriptional regulators
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGDEVIVPKSIKRAKGNQSSKKSKKDKKSSNP
ccccHHHHHHHHHHHHHHEEEcHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHccccccccHHHHHHcccHHHHHHHHHHccccc
ccccHHHHHHHHHHHHHHEEEcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHccccccHHEHccccccccccccHHHHHHHHcccccEEEEccccccccHHHHccccccccccccccccccc
MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSIRYALYLRNEyeisfdwiydgevidRRYEdvtnkkrldpyaIGARLKSIrkdkgmsqiefgkllgmpnstlsnyeqgrtipeikparKIKQVTKKHLdwiyfgdevivpksikrakgnqsskkskkdkkssnp
MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRyedvtnkkrldpyaigarlksirkdkgmSQIEfgkllgmpnstLSNYEQGrtipeikparkikqvtkkhldwiyfgdevivpksikrakgnqsskkskkdkkssnp
MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGDEVIVPKSIKRAKGNQsskkskkdkkssNP
*******ETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGD*****************************
MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGDEVIVPKSIK********************
*FLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGDEVIVPKSIKR*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGDEVIVPKSIKRAKGNQSSKKSKKDKKSSNP
MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGDEVIVPKSIKRAKGNQSSKKSKKDKKSSNP
MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGDEVIVPKSIKRAKGNQSSKKSKKDKKSSNP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target205 hypothetical protein CLIBASIA_05625 [Candidatus Liberib
254780424144 transcriptional regulator protein [Candidatus Libe 0.024
>gi|254780424|ref|YP_003064837.1| transcriptional regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 144 Back     alignment
 Score = 30.4 bits (67), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 103 VTNKKRLDPYAI--GARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQG 149
           V NKK  +P  I  G R++  R   GMSQ + G+ LG+    +  YE+G
Sbjct: 2   VGNKKIPNPVDINVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKG 50

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target205 hypothetical protein CLIBASIA_05625 [Candidatus Liberib
317120724199 hypothetical protein SC2_gp125 [Liberibacter phage SC2] 1 3e-74
315122578174 hypothetical protein CKC_04150 [Candidatus Liberibacter 1 3e-52
315122488185 hypothetical protein CKC_03700 [Candidatus Liberibacter 1 1e-38
315121942193 hypothetical protein CKC_00960 [Candidatus Liberibacter 1 1e-31
315122910251 hypothetical protein CKC_05830 [Candidatus Liberibacter 1 3e-31
315122908210 hypothetical protein CKC_05820 [Candidatus Liberibacter 1 5e-31
325570741 287 cro/CI family transcriptional regulator [Enterococcus c 1 2e-06
293400467162 toxin-antitoxin system, antitoxin component, Xre family 1 1e-05
2897106121 repressor [Streptococcus phage TP-J34] Length = 121 1 3e-05
302873538 296 transcriptional regulator, XRE family [Clostridium cell 1 4e-05
>gi|317120724|gb|ADV02546.1| hypothetical protein SC2_gp125 [Liberibacter phage SC2] Length = 199 Back     alignment and organism information
 Score =  282 bits (721), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 139/199 (69%), Positives = 162/199 (81%), Gaps = 1/199 (0%)

Query: 1   MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESA 60
           MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRI+DIRK+ +KT  E+A  ANQ ES 
Sbjct: 1   MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIRDIRKSKDKTLDEIAKEANQTEST 60

Query: 61  VNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNK-KRLDPYAIGARLK 119
           +  FENG+CSTSI YAL LRNEYEISFDWIYDGE I + Y+  T K   LDP AIG RLK
Sbjct: 61  IWKFENGLCSTSINYALCLRNEYEISFDWIYDGETILKVYKPKTLKGDVLDPVAIGLRLK 120

Query: 120 SIRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGDEVI 179
            IR+  G++++EFGKL+G+P + +S YE G+  P I  A+ IKQ TKKHLDWIYFGDEVI
Sbjct: 121 EIREHLGLNRVEFGKLVGLPCALISMYESGKRTPRITTAQNIKQATKKHLDWIYFGDEVI 180

Query: 180 VPKSIKRAKGNQSSKKSKK 198
           +PKSIKRAK NQSS+K+K+
Sbjct: 181 IPKSIKRAKANQSSRKAKE 199


Species: Liberibacter phage SC2
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|315122578|ref|YP_004063067.1| hypothetical protein CKC_04150 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 174 Back     alignment and organism information
>gi|315122488|ref|YP_004062977.1| hypothetical protein CKC_03700 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 185 Back     alignment and organism information
>gi|315121942|ref|YP_004062431.1| hypothetical protein CKC_00960 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 193 Back     alignment and organism information
>gi|315122910|ref|YP_004063399.1| hypothetical protein CKC_05830 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 251 Back     alignment and organism information
>gi|315122908|ref|YP_004063397.1| hypothetical protein CKC_05820 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 210 Back     alignment and organism information
>gi|325570741|ref|ZP_08146467.1| cro/CI family transcriptional regulator [Enterococcus casseliflavus ATCC 12755] Length = 287 Back     alignment and organism information
>gi|293400467|ref|ZP_06644612.1| toxin-antitoxin system, antitoxin component, Xre family [Erysipelotrichaceae bacterium 5_2_54FAA] Length = 162 Back     alignment and organism information
>gi|2897106|gb|AAC03457.1| repressor [Streptococcus phage TP-J34] Length = 121 Back     alignment and organism information
>gi|302873538|ref|YP_003842171.1| transcriptional regulator, XRE family [Clostridium cellulovorans 743B] Length = 296 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 hypothetical protein CLIBASIA_05625 [Candidatus Liberib
smart0053056 smart00530, HTH_XRE, Helix-turn-helix XRE-family like p 2e-08
pfam0138155 pfam01381, HTH_3, Helix-turn-helix 1e-07
COG2944104 COG2944, COG2944, Predicted transcriptional regulator [ 6e-06
PRK09706135 PRK09706, PRK09706, transcriptional repressor DicA; Rev 7e-05
TIGR03830127 TIGR03830, CxxCG_CxxCG_HTH, putative zinc finger/helix- 1e-04
COG147668 COG1476, COG1476, Predicted transcriptional regulators 5e-04
PRK09943185 PRK09943, PRK09943, DNA-binding transcriptional repress 6e-04
COG1396120 COG1396, HipB, Predicted transcriptional regulators [Tr 7e-04
COG1813165 COG1813, COG1813, Predicted transcription factor, homol 0.003
cd0009358 cd00093, HTH_XRE, Helix-turn-helix XRE-family like prot 2e-08
cd0009358 cd00093, HTH_XRE, Helix-turn-helix XRE-family like prot 0.002
>gnl|CDD|128803 smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>gnl|CDD|144828 pfam01381, HTH_3, Helix-turn-helix Back     alignment and domain information
>gnl|CDD|32767 COG2944, COG2944, Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>gnl|CDD|182039 PRK09706, PRK09706, transcriptional repressor DicA; Reviewed Back     alignment and domain information
>gnl|CDD|163542 TIGR03830, CxxCG_CxxCG_HTH, putative zinc finger/helix-turn-helix protein, YgiT family Back     alignment and domain information
>gnl|CDD|31665 COG1476, COG1476, Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>gnl|CDD|182158 PRK09943, PRK09943, DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>gnl|CDD|31586 COG1396, HipB, Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>gnl|CDD|31998 COG1813, COG1813, Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription] Back     alignment and domain information
>gnl|CDD|28977 cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>gnl|CDD|28977 cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 205 hypothetical protein CLIBASIA_05625 [Candidatus Liberib
PRK09706135 transcriptional repressor DicA; Reviewed 99.72
PHA0197667 helix-turn-helix protein 99.7
PRK09943185 DNA-binding transcriptional repressor PuuR; Provisional 99.57
TIGR0307058 couple_hipB transcriptional regulator, y4mF family. Mem 99.37
pfam0138155 HTH_3 Helix-turn-helix. This large family of DNA bindin 99.36
smart0053056 HTH_XRE Helix-turn-helix XRE-family like proteins. 99.36
COG147668 Predicted transcriptional regulators [Transcription] 99.28
PRK13890119 conjugal transfer protein TrbA; Provisional 99.27
cd0009358 HTH_XRE Helix-turn-helix XRE-family like proteins. Prok 99.22
PRK0972688 DNA-binding transcriptional regulator HipB; Provisional 99.06
COG1813165 Predicted transcription factor, homolog of eukaryotic M 98.85
PRK06424144 transcription factor; Provisional 98.79
PRK08359175 transcription factor; Validated 98.76
PRK13355 518 bifunctional HTH-domain containing protein/aminotransfe 98.65
TIGR0260781 antidote_HigA addiction module antidote protein, HigA f 98.45
COG1395313 Predicted transcriptional regulator [Transcription] 98.39
TIGR00270169 TIGR00270 conserved hypothetical protein TIGR00270; Int 98.35
KOG3398135 consensus 98.29
COG2944104 Predicted transcriptional regulator [Transcription] 98.29
COG1709241 Predicted transcriptional regulator [Transcription] 98.27
COG3093104 VapI Plasmid maintenance system antidote protein [Gener 98.18
COG1396120 HipB Predicted transcriptional regulators [Transcriptio 98.1
COG1426 284 Predicted transcriptional regulator contains Xre-like H 98.05
pfam0702265 Phage_CI_repr Bacteriophage CI repressor helix-turn-hel 97.96
PRK10856 332 hypothetical protein; Provisional 97.94
TIGR02612150 mob_myst_A mobile mystery protein A; InterPro: IPR01343 97.86
PRK1007296 putative transcriptional regulator; Provisional 97.85
COG365573 Predicted transcriptional regulator [Transcription] 97.63
COG5499120 Predicted transcription regulator containing HTH domain 97.25
COG4800170 Predicted transcriptional regulator with an HTH domain 97.2
COG2522119 Predicted transcriptional regulator [General function p 96.69
PHA0054282 putative Cro-like protein 96.61
TIGR0268491 dnstrm_HI1420 probable addiction module antidote protei 96.5
PRK02866147 cyanate hydratase; Validated 96.26
pfam08667146 BetR BetR domain. This family includes an N-terminal he 96.03
smart0035275 POU Found in Pit-Oct-Unc transcription factors. 95.72
PRK08558238 adenine phosphoribosyltransferase; Provisional 95.46
pfam0015775 Pou Pou domain - N-terminal to homeobox domain. 95.43
COG560691 Uncharacterized conserved small protein [Function unkno 95.42
PRK09526 342 lacI lac repressor; Reviewed 94.69
PRK09492 315 treR trehalose repressor; Provisional 94.61
PRK10014 342 DNA-binding transcriptional repressor MalI; Provisional 94.6
COG2390 321 DeoR Transcriptional regulator, contains sigma factor-r 94.55
TIGR0132195 TrpR trp operon repressor; InterPro: IPR013335 The Trp 94.46
COG2973103 TrpR Trp operon repressor [Transcription] 93.85
PRK11303 330 DNA-binding transcriptional regulator FruR; Provisional 93.63
COG3636100 Predicted transcriptional regulator [Transcription] 93.53
pfam0035646 LacI Bacterial regulatory proteins, lacI family. 93.07
PRK10401 346 DNA-binding transcriptional regulator GalS; Provisional 92.84
COG1356143 tfx Transcriptional regulator [DNA replication, recombi 92.68
PRK10727 342 DNA-binding transcriptional regulator GalR; Provisional 92.58
PRK11041 341 DNA-binding transcriptional regulator CytR; Provisional 92.3
PRK10703 335 DNA-binding transcriptional repressor PurR; Provisional 92.24
PRK08099 411 nicotinamide-nucleotide adenylyltransferase; Provisiona 92.02
PRK0138199 Trp operon repressor; Provisional 91.93
COG1609 333 PurR Transcriptional regulators [Transcription] 91.89
PRK10339 327 DNA-binding transcriptional repressor EbgR; Provisional 91.73
pfam08965117 DUF1870 Domain of unknown function (DUF1870). This doma 91.25
PRK09706135 transcriptional repressor DicA; Reviewed 99.71
PHA0197667 helix-turn-helix protein 99.61
PRK09943185 DNA-binding transcriptional repressor PuuR; Provisional 99.51
smart0053056 HTH_XRE Helix-turn-helix XRE-family like proteins. 99.29
pfam0138155 HTH_3 Helix-turn-helix. This large family of DNA bindin 99.27
COG147668 Predicted transcriptional regulators [Transcription] 99.15
TIGR0307058 couple_hipB transcriptional regulator, y4mF family. Mem 99.13
PRK13890119 conjugal transfer protein TrbA; Provisional 99.13
cd0009358 HTH_XRE Helix-turn-helix XRE-family like proteins. Prok 99.12
PRK08154 304 anaerobic benzoate catabolism transcriptional regulator 99.08
COG1813165 Predicted transcription factor, homolog of eukaryotic M 98.98
PRK06424144 transcription factor; Provisional 98.98
PRK08359175 transcription factor; Validated 98.92
PRK0972688 DNA-binding transcriptional regulator HipB; Provisional 98.83
PRK04140 319 hypothetical protein; Provisional 98.68
PRK13355 518 bifunctional HTH-domain containing protein/aminotransfe 98.55
pfam0702265 Phage_CI_repr Bacteriophage CI repressor helix-turn-hel 98.42
COG2944104 Predicted transcriptional regulator [Transcription] 98.39
COG1395313 Predicted transcriptional regulator [Transcription] 98.36
COG3620187 Predicted transcriptional regulator with C-terminal CBS 98.34
TIGR0260781 antidote_HigA addiction module antidote protein, HigA f 98.32
COG1709 241 Predicted transcriptional regulator [Transcription] 98.21
PRK1007296 putative transcriptional regulator; Provisional 98.16
COG3093104 VapI Plasmid maintenance system antidote protein [Gener 98.15
TIGR00270169 TIGR00270 conserved hypothetical protein TIGR00270; Int 97.95
COG1396120 HipB Predicted transcriptional regulators [Transcriptio 97.92
TIGR02612150 mob_myst_A mobile mystery protein A; InterPro: IPR01343 97.84
COG1426 284 Predicted transcriptional regulator contains Xre-like H 97.83
PRK10856 332 hypothetical protein; Provisional 97.7
COG365573 Predicted transcriptional regulator [Transcription] 97.47
TIGR0268491 dnstrm_HI1420 probable addiction module antidote protei 97.34
COG5499120 Predicted transcription regulator containing HTH domain 97.3
pfam08667146 BetR BetR domain. This family includes an N-terminal he 97.23
COG4800170 Predicted transcriptional regulator with an HTH domain 96.8
PRK05932461 RNA polymerase factor sigma-54; Reviewed 96.71
PRK02866147 cyanate hydratase; Validated 96.23
PRK12469475 RNA polymerase factor sigma-54; Provisional 96.14
COG1191247 FliA DNA-directed RNA polymerase specialized sigma subu 95.9
PHA0054282 putative Cro-like protein 95.52
pfam04814177 HNF-1_N Hepatocyte nuclear factor 1 (HNF-1), N terminus 94.92
COG3636100 Predicted transcriptional regulator [Transcription] 94.63
PRK10014 342 DNA-binding transcriptional repressor MalI; Provisional 94.42
PRK09492 315 treR trehalose repressor; Provisional 94.32
PRK09526 342 lacI lac repressor; Reviewed 93.98
PRK08558 238 adenine phosphoribosyltransferase; Provisional 93.98
pfam0533969 DUF739 Protein of unknown function (DUF739). This famil 93.87
COG560691 Uncharacterized conserved small protein [Function unkno 93.87
pfam0035646 LacI Bacterial regulatory proteins, lacI family. 93.52
smart0035275 POU Found in Pit-Oct-Unc transcription factors. 93.08
smart0035470 HTH_LACI helix_turn _helix lactose operon repressor. 92.66
COG1609 333 PurR Transcriptional regulators [Transcription] 91.23
pfam0015775 Pou Pou domain - N-terminal to homeobox domain. 91.16
KOG3802398 consensus 91.15
COG419796 Uncharacterized protein conserved in bacteria, prophage 90.41
PRK1034490 DNA-binding transcriptional regulator Nlp; Provisional 90.23
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 99.37
PRK04140319 hypothetical protein; Provisional 98.71
KOG3398135 consensus 98.39
pfam04552160 Sigma54_DBD Sigma-54, DNA binding domain. This DNA bind 96.65
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 96.6
COG1508444 RpoN DNA-directed RNA polymerase specialized sigma subu 96.11
KOG3802398 consensus 96.05
PRK06986234 fliA flagellar biosynthesis sigma factor; Validated 94.95
TIGR02395477 rpoN_sigma RNA polymerase sigma-54 factor; InterPro: IP 94.19
KOG1168385 consensus 92.77
PRK05657328 RNA polymerase sigma factor RpoS; Validated 92.77
PRK07500289 rpoH2 RNA polymerase factor sigma-32; Reviewed 91.05
COG3620187 Predicted transcriptional regulator with C-terminal CBS 98.9
TIGR02885231 spore_sigF RNA polymerase sigma-F factor; InterPro: IPR 97.38
PRK07122263 RNA polymerase sigma factor SigF; Reviewed 96.21
pfam07900220 DUF1670 Protein of unknown function (DUF1670). The hypo 95.83
TIGR02980229 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subf 95.83
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 95.76
PRK06288261 RNA polymerase sigma factor WhiG; Reviewed 95.69
PRK12427229 flagellar biosynthesis sigma factor; Provisional 95.43
PRK08583257 RNA polymerase sigma factor SigB; Validated 94.96
PRK07670250 RNA polymerase sigma factor SigD; Validated 94.68
pfam01710120 Transposase_14 Transposase. Transposase proteins are ne 94.1
PRK05901398 RNA polymerase sigma factor; Provisional 93.49
TIGR00673156 cynS cyanate hydratase; InterPro: IPR008076 Cyanase, an 93.08
PRK07405318 RNA polymerase sigma factor SigD; Validated 92.97
PRK09210368 RNA polymerase sigma factor RpoD; Validated 92.45
cd0478095 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding domain o 91.6
PRK05572251 sporulation sigma factor SigF; Validated 91.02
cd0477496 HTH_YfmP Helix-Turn-Helix DNA binding domain of the Yfm 90.63
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon control pro 90.52
COG2522119 Predicted transcriptional regulator [General function p 96.35
COG1191247 FliA DNA-directed RNA polymerase specialized sigma subu 93.38
pfam0237681 CUT CUT domain. The CUT domain is a DNA-binding motif w 92.36
cd0476249 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of t 91.83
TIGR02846228 spore_sigmaK RNA polymerase sigma-K factor; InterPro: I 96.05
PRK03975139 tfx putative transcriptional regulator; Provisional 95.16
TIGR02980229 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subf 94.79
TIGR00721142 tfx DNA-binding protein, Tfx family; InterPro: IPR00464 94.45
TIGR02885231 spore_sigF RNA polymerase sigma-F factor; InterPro: IPR 93.95
smart0035470 HTH_LACI helix_turn _helix lactose operon repressor. 92.84
PRK10703 335 DNA-binding transcriptional repressor PurR; Provisional 91.42
pfam0137188 Trp_repressor Trp repressor protein. This protein binds 90.58
pfam04814177 HNF-1_N Hepatocyte nuclear factor 1 (HNF-1), N terminus 92.59
>PRK09706 transcriptional repressor DicA; Reviewed Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>TIGR03070 couple_hipB transcriptional regulator, y4mF family Back     alignment and domain information
>pfam01381 HTH_3 Helix-turn-helix Back     alignment and domain information
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>COG1476 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK13890 conjugal transfer protein TrbA; Provisional Back     alignment and domain information
>cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>PRK09726 DNA-binding transcriptional regulator HipB; Provisional Back     alignment and domain information
>COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription] Back     alignment and domain information
>PRK06424 transcription factor; Provisional Back     alignment and domain information
>PRK08359 transcription factor; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>TIGR02607 antidote_HigA addiction module antidote protein, HigA family; InterPro: IPR013430 Proteins in this entry form a distinct group of helix-turn-helix proteins, which are strictly bacterial and nearly always shorter than 110 amino acids Back     alignment and domain information
>COG1395 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR00270 TIGR00270 conserved hypothetical protein TIGR00270; InterPro: IPR004451 This family of conserved hypothetical proteins includes proteins of unknown function from archaebacteria Back     alignment and domain information
>KOG3398 consensus Back     alignment and domain information
>COG2944 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1709 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG3093 VapI Plasmid maintenance system antidote protein [General function prediction only] Back     alignment and domain information
>COG1396 HipB Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>COG1426 Predicted transcriptional regulator contains Xre-like HTH domain [Function unknown] Back     alignment and domain information
>pfam07022 Phage_CI_repr Bacteriophage CI repressor helix-turn-helix domain Back     alignment and domain information
>PRK10856 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02612 mob_myst_A mobile mystery protein A; InterPro: IPR013435 Proteins in this entry are more often encoded within mobilisation-related contexts than not Back     alignment and domain information
>PRK10072 putative transcriptional regulator; Provisional Back     alignment and domain information
>COG3655 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG5499 Predicted transcription regulator containing HTH domain [Transcription] Back     alignment and domain information
>COG4800 Predicted transcriptional regulator with an HTH domain [Transcription] Back     alignment and domain information
>COG2522 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>TIGR02684 dnstrm_HI1420 probable addiction module antidote protein; InterPro: IPR014057 Members of this strictly bacterial protein family are small, at roughly 100 amino acids Back     alignment and domain information
>PRK02866 cyanate hydratase; Validated Back     alignment and domain information
>pfam08667 BetR BetR domain Back     alignment and domain information
>smart00352 POU Found in Pit-Oct-Unc transcription factors Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>pfam00157 Pou Pou domain - N-terminal to homeobox domain Back     alignment and domain information
>COG5606 Uncharacterized conserved small protein [Function unknown] Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor; InterPro: IPR013335 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>COG2973 TrpR Trp operon repressor [Transcription] Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>COG3636 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>pfam00356 LacI Bacterial regulatory proteins, lacI family Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>COG1356 tfx Transcriptional regulator [DNA replication, recombination and repair] Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>PRK11041 DNA-binding transcriptional regulator CytR; Provisional Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>PRK08099 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK01381 Trp operon repressor; Provisional Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional Back     alignment and domain information
>pfam08965 DUF1870 Domain of unknown function (DUF1870) Back     alignment and domain information
>PRK09706 transcriptional repressor DicA; Reviewed Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>pfam01381 HTH_3 Helix-turn-helix Back     alignment and domain information
>COG1476 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR03070 couple_hipB transcriptional regulator, y4mF family Back     alignment and domain information
>PRK13890 conjugal transfer protein TrbA; Provisional Back     alignment and domain information
>cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription] Back     alignment and domain information
>PRK06424 transcription factor; Provisional Back     alignment and domain information
>PRK08359 transcription factor; Validated Back     alignment and domain information
>PRK09726 DNA-binding transcriptional regulator HipB; Provisional Back     alignment and domain information
>PRK04140 hypothetical protein; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>pfam07022 Phage_CI_repr Bacteriophage CI repressor helix-turn-helix domain Back     alignment and domain information
>COG2944 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1395 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>TIGR02607 antidote_HigA addiction module antidote protein, HigA family; InterPro: IPR013430 Proteins in this entry form a distinct group of helix-turn-helix proteins, which are strictly bacterial and nearly always shorter than 110 amino acids Back     alignment and domain information
>COG1709 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10072 putative transcriptional regulator; Provisional Back     alignment and domain information
>COG3093 VapI Plasmid maintenance system antidote protein [General function prediction only] Back     alignment and domain information
>TIGR00270 TIGR00270 conserved hypothetical protein TIGR00270; InterPro: IPR004451 This family of conserved hypothetical proteins includes proteins of unknown function from archaebacteria Back     alignment and domain information
>COG1396 HipB Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR02612 mob_myst_A mobile mystery protein A; InterPro: IPR013435 Proteins in this entry are more often encoded within mobilisation-related contexts than not Back     alignment and domain information
>COG1426 Predicted transcriptional regulator contains Xre-like HTH domain [Function unknown] Back     alignment and domain information
>PRK10856 hypothetical protein; Provisional Back     alignment and domain information
>COG3655 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02684 dnstrm_HI1420 probable addiction module antidote protein; InterPro: IPR014057 Members of this strictly bacterial protein family are small, at roughly 100 amino acids Back     alignment and domain information
>COG5499 Predicted transcription regulator containing HTH domain [Transcription] Back     alignment and domain information
>pfam08667 BetR BetR domain Back     alignment and domain information
>COG4800 Predicted transcriptional regulator with an HTH domain [Transcription] Back     alignment and domain information
>PRK05932 RNA polymerase factor sigma-54; Reviewed Back     alignment and domain information
>PRK02866 cyanate hydratase; Validated Back     alignment and domain information
>PRK12469 RNA polymerase factor sigma-54; Provisional Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>pfam04814 HNF-1_N Hepatocyte nuclear factor 1 (HNF-1), N terminus Back     alignment and domain information
>COG3636 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>pfam05339 DUF739 Protein of unknown function (DUF739) Back     alignment and domain information
>COG5606 Uncharacterized conserved small protein [Function unknown] Back     alignment and domain information
>pfam00356 LacI Bacterial regulatory proteins, lacI family Back     alignment and domain information
>smart00352 POU Found in Pit-Oct-Unc transcription factors Back     alignment and domain information
>smart00354 HTH_LACI helix_turn _helix lactose operon repressor Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>pfam00157 Pou Pou domain - N-terminal to homeobox domain Back     alignment and domain information
>KOG3802 consensus Back     alignment and domain information
>COG4197 Uncharacterized protein conserved in bacteria, prophage-related [Function unknown] Back     alignment and domain information
>PRK10344 DNA-binding transcriptional regulator Nlp; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK04140 hypothetical protein; Provisional Back     alignment and domain information
>KOG3398 consensus Back     alignment and domain information
>pfam04552 Sigma54_DBD Sigma-54, DNA binding domain Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>COG1508 RpoN DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog [Transcription] Back     alignment and domain information
>KOG3802 consensus Back     alignment and domain information
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>TIGR02395 rpoN_sigma RNA polymerase sigma-54 factor; InterPro: IPR000394 Sigma factors are bacterial transcription initiation factors that promote the attachment of the core RNA polymerase to specific initiation sites and are then released Back     alignment and domain information
>KOG1168 consensus Back     alignment and domain information
>PRK05657 RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>TIGR02885 spore_sigF RNA polymerase sigma-F factor; InterPro: IPR014236 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK07122 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>pfam07900 DUF1670 Protein of unknown function (DUF1670) Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily; InterPro: IPR014322 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>PRK12427 flagellar biosynthesis sigma factor; Provisional Back     alignment and domain information
>PRK08583 RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>PRK07670 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>pfam01710 Transposase_14 Transposase Back     alignment and domain information
>PRK05901 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR00673 cynS cyanate hydratase; InterPro: IPR008076 Cyanase, an enzyme found in bacteria and plants, catalyses the reaction of cyanate with bicarbonate to produce ammonia and carbon dioxide, allowing the host organisms to overcome the toxicity of environmental cyanate Back     alignment and domain information
>PRK07405 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PRK09210 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>cd04780 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PRK05572 sporulation sigma factor SigF; Validated Back     alignment and domain information
>cd04774 HTH_YfmP Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>COG2522 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>pfam02376 CUT CUT domain Back     alignment and domain information
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins Back     alignment and domain information
>TIGR02846 spore_sigmaK RNA polymerase sigma-K factor; InterPro: IPR014209 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily; InterPro: IPR014322 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR00721 tfx DNA-binding protein, Tfx family; InterPro: IPR004645 This is a family of Tfx DNA-binding proteins, which is restricted to the archaea Back     alignment and domain information
>TIGR02885 spore_sigF RNA polymerase sigma-F factor; InterPro: IPR014236 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>smart00354 HTH_LACI helix_turn _helix lactose operon repressor Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>pfam01371 Trp_repressor Trp repressor protein Back     alignment and domain information
>pfam04814 HNF-1_N Hepatocyte nuclear factor 1 (HNF-1), N terminus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target205 hypothetical protein CLIBASIA_05625 [Candidatus Liberib
1sq8_A64 A Variant 434 Repressor Dna Binding Domain Devoid O 1e-09
1adr_A76 Determination Of The Nuclear Magnetic Resonance Str 2e-09
3jxb_C67 Crystal Structure Of The P22 C2 Repressor Protein I 3e-09
2r1j_L68 Crystal Structure Of The P22 C2 Repressor Protein I 3e-09
2p5t_A158 Molecular And Structural Characterization Of The Pe 5e-09
1pra_A69 Determination Of The Nuclear Magnetic Resonance Sol 2e-08
2or1_L69 Recognition Of A Dna Operator By The Repressor Of P 2e-08
1y7y_A74 High-Resolution Crystal Structure Of The Restrictio 2e-08
1r63_A63 Structural Role Of A Buried Salt Bridge In The 434 2e-08
1y9q_A192 Crystal Structure Of Hth_3 Family Transcriptional R 3e-08
2xj3_A66 High Resolution Structure Of The T55c Mutant Of Cyl 7e-08
1utx_A66 Regulation Of Cytolysin Expression By Enterococcus 2e-07
2r63_A63 Structural Role Of A Buried Salt Bridge In The 434 2e-07
1sq8_A64 A Variant 434 Repressor Dna Binding Domain Devoid O 2e-05
1adr_A76 Determination Of The Nuclear Magnetic Resonance Str 5e-09
3jxb_C67 Crystal Structure Of The P22 C2 Repressor Protein I 2e-08
2r1j_L68 Crystal Structure Of The P22 C2 Repressor Protein I 8e-09
2p5t_A158 Molecular And Structural Characterization Of The Pe 1e-05
1pra_A69 Determination Of The Nuclear Magnetic Resonance Sol 4e-04
2or1_L69 Recognition Of A Dna Operator By The Repressor Of P 4e-04
1y7y_A74 High-Resolution Crystal Structure Of The Restrictio 3e-05
1r63_A63 Structural Role Of A Buried Salt Bridge In The 434 4e-04
1b0n_A111 Sinr ProteinSINI PROTEIN COMPLEX Length = 111 5e-05
1y9q_A192 Crystal Structure Of Hth_3 Family Transcriptional R 7e-07
2xj3_A66 High Resolution Structure Of The T55c Mutant Of Cyl 1e-06
1utx_A66 Regulation Of Cytolysin Expression By Enterococcus 3e-06
2r63_A63 Structural Role Of A Buried Salt Bridge In The 434 0.002
1b0n_A111 Sinr ProteinSINI PROTEIN COMPLEX Length = 111 3e-08
>gi|51247424|pdb|1SQ8|A Chain A, A Variant 434 Repressor Dna Binding Domain Devoid Of Hydroxyl Groups, Nmr, 20 Structures Length = 64 Back     alignment and structure
 Score = 67.7 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 1/62 (1%)

Query: 32 VGTRIKDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSIRYALYLRNEYEISFDWIY 91
          +G RI+  R      Q E+A      + A+   ENG      R+   L     ++ DW+ 
Sbjct: 3  MGERIRARRIQLGLNQAELAQKVGVDQQAIEQLENGKAK-RPRFLPELARALGVAVDWLL 61

Query: 92 DG 93
          +G
Sbjct: 62 NG 63


>gi|157829815|pdb|1ADR|A Chain A, Determination Of The Nuclear Magnetic Resonance Structure Of The Dna-Binding Domain Of The P22 C2 Repressor (1-76) In Solution And Comparison With The Dna-Binding Domain Of The 434 Repressor Length = 76 Back     alignment and structure
>gi|284055653|pdb|3JXB|C Chain C, Crystal Structure Of The P22 C2 Repressor Protein In Complex With Synthetic Operator 9c Length = 67 Back     alignment and structure
>gi|186972781|pdb|2R1J|L Chain L, Crystal Structure Of The P22 C2 Repressor Protein In Complex With The Synthetic Operator 9t Length = 68 Back     alignment and structure
gi|149242896|pdb|2P5T|A Chain A, Molecular And Structural Characterization Of The Pezat Chromosomal Toxin-Antitoxin System Of The Human Pathogen Streptococcus Pneumoniae Length = 158 Back     alignment and structure
>gi|253723068|pdb|1PRA|A Chain A, Determination Of The Nuclear Magnetic Resonance Solution Structure Of The Dna-Binding Domain (Residues 1 To 69) Of The 434 Repressor And Comparison With The X-Ray Crystal Structure Length = 69 Back     alignment and structure
>gi|230647|pdb|2OR1|L Chain L, Recognition Of A Dna Operator By The Repressor Of Phage 434. A View At High Resolution Length = 69 Back     alignment and structure
>gi|61680543|pdb|1Y7Y|A Chain A, High-Resolution Crystal Structure Of The Restriction- Modification Controller Protein C.Ahdi From Aeromonas Hydrophila Length = 74 Back     alignment and structure
>gi|157833618|pdb|1R63|A Chain A, Structural Role Of A Buried Salt Bridge In The 434 Repressor Dna-Binding Domain, Nmr, 20 Structures Length = 63 Back     alignment and structure
>gi|60594530|pdb|1Y9Q|A Chain A, Crystal Structure Of Hth_3 Family Transcriptional Regulator From Vibrio Cholerae Length = 192 Back     alignment and structure
>gi|322812212|pdb|2XJ3|A Chain A, High Resolution Structure Of The T55c Mutant Of Cylr2. Length = 66 Back     alignment and structure
gi|55670390|pdb|1UTX|A Chain A, Regulation Of Cytolysin Expression By Enterococcus Faecalis: Role Of Cylr2 Length = 66 Back     alignment and structure
>gi|157836326|pdb|2R63|A Chain A, Structural Role Of A Buried Salt Bridge In The 434 Repressor Dna-Binding Domain, Nmr, 20 Structures Length = 63 Back     alignment and structure
>gi|51247424|pdb|1SQ8|A Chain A, A Variant 434 Repressor Dna Binding Domain Devoid Of Hydroxyl Groups, Nmr, 20 Structures Length = 64 Back     alignment and structure
>gi|157829815|pdb|1ADR|A Chain A, Determination Of The Nuclear Magnetic Resonance Structure Of The Dna-Binding Domain Of The P22 C2 Repressor (1-76) In Solution And Comparison With The Dna-Binding Domain Of The 434 Repressor Length = 76 Back     alignment and structure
>gi|284055653|pdb|3JXB|C Chain C, Crystal Structure Of The P22 C2 Repressor Protein In Complex With Synthetic Operator 9c Length = 67 Back     alignment and structure
>gi|186972781|pdb|2R1J|L Chain L, Crystal Structure Of The P22 C2 Repressor Protein In Complex With The Synthetic Operator 9t Length = 68 Back     alignment and structure
gi|149242896|pdb|2P5T|A Chain A, Molecular And Structural Characterization Of The Pezat Chromosomal Toxin-Antitoxin System Of The Human Pathogen Streptococcus Pneumoniae Length = 158 Back     alignment and structure
>gi|253723068|pdb|1PRA|A Chain A, Determination Of The Nuclear Magnetic Resonance Solution Structure Of The Dna-Binding Domain (Residues 1 To 69) Of The 434 Repressor And Comparison With The X-Ray Crystal Structure Length = 69 Back     alignment and structure
>gi|230647|pdb|2OR1|L Chain L, Recognition Of A Dna Operator By The Repressor Of Phage 434. A View At High Resolution Length = 69 Back     alignment and structure
>gi|61680543|pdb|1Y7Y|A Chain A, High-Resolution Crystal Structure Of The Restriction- Modification Controller Protein C.Ahdi From Aeromonas Hydrophila Length = 74 Back     alignment and structure
>gi|157833618|pdb|1R63|A Chain A, Structural Role Of A Buried Salt Bridge In The 434 Repressor Dna-Binding Domain, Nmr, 20 Structures Length = 63 Back     alignment and structure
gi|4389349|pdb|1B0N|A Chain A, Sinr ProteinSINI PROTEIN COMPLEX Length = 111 Back     alignment and structure
>gi|60594530|pdb|1Y9Q|A Chain A, Crystal Structure Of Hth_3 Family Transcriptional Regulator From Vibrio Cholerae Length = 192 Back     alignment and structure
>gi|322812212|pdb|2XJ3|A Chain A, High Resolution Structure Of The T55c Mutant Of Cylr2. Length = 66 Back     alignment and structure
gi|55670390|pdb|1UTX|A Chain A, Regulation Of Cytolysin Expression By Enterococcus Faecalis: Role Of Cylr2 Length = 66 Back     alignment and structure
>gi|157836326|pdb|2R63|A Chain A, Structural Role Of A Buried Salt Bridge In The 434 Repressor Dna-Binding Domain, Nmr, 20 Structures Length = 63 Back     alignment and structure
gi|4389349|pdb|1B0N|A Chain A, Sinr ProteinSINI PROTEIN COMPLEX Length = 111 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 hypothetical protein CLIBASIA_05625 [Candidatus Liberib
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, DNA- 1e-11
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-turn-h 6e-10
3mlf_A111 Transcriptional regulator; structural genomics, helix-t 1e-09
3kxa_A141 NGO0477 protein, putative uncharacterized protein; NEW 1e-09
1adr_A76 P22 C2 repressor; transcription regulation; NMR {Bacter 3e-09
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, transcri 6e-09
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif 6e-09
1r69_A69 Repressor protein CI; gene regulating protein; 2.00A {P 7e-09
2p5t_A158 Putative transcriptional regulator PEZA; postsegregatio 8e-09
1y9q_A192 Transcriptional regulator, HTH_3 family; transcriptiona 9e-09
3ivp_A126 Putative transposon-related DNA-binding protein; APC626 1e-08
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1.54A 2e-08
2wiu_B88 HTH-type transcriptional regulator HIPB; transferase tr 5e-08
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, protein binding, 2e-07
1zug_A71 Phage 434 CRO protein; gene regulating protein, transcr 2e-07
1b0n_A111 Protein (SINR protein); transcription regulator, antago 2e-07
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B3021); h 3e-07
1x57_A91 Endothelial differentiation-related factor 1; HMBF1alph 7e-07
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-dependant 1e-06
3kz3_A80 Repressor protein CI; five helix bundle, DNA-binding, t 2e-06
3omt_A73 Uncharacterized protein; structural genomics, PSI-2, pr 4e-06
1utx_A66 CYLR2; DNA-binding protein, transcriptional repressor, 5e-06
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA binding 6e-06
3op9_A114 PLI0006 protein; structural genomics, PSI-2, protein st 8e-06
1lmb_392 Protein (lambda repressor); protein-DNA complex, double 2e-05
3bdn_A 236 Lambda repressor; repressor, allostery; HET: DNA; 3.91A 8e-05
3clc_A82 Regulatory protein; protein-DNA complex, transcriptiona 1e-04
2qfc_A 293 PLCR protein; TPR, HTH, transcription regulation; 2.60A 2e-04
2wus_R112 RODZ, putative uncharacterized protein; structural prot 6e-04
2awi_A 317 PRGX; repressor, pheromone, DNA binding, regulatory dom 7e-04
3g5g_A99 Regulatory protein; transcriptional regulator, helix-tu 0.001
3g7d_A 443 PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic 0.003
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, DNA- 7e-04
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-turn-h 6e-06
3mlf_A111 Transcriptional regulator; structural genomics, helix-t 4e-06
3kxa_A141 NGO0477 protein, putative uncharacterized protein; NEW 2e-05
1adr_A76 P22 C2 repressor; transcription regulation; NMR {Bacter 2e-05
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, transcri 4e-04
1r69_A69 Repressor protein CI; gene regulating protein; 2.00A {P 6e-04
1y9q_A192 Transcriptional regulator, HTH_3 family; transcriptiona 2e-05
3ivp_A126 Putative transposon-related DNA-binding protein; APC626 5e-04
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1.54A 3e-04
2wiu_B88 HTH-type transcriptional regulator HIPB; transferase tr 7e-04
1zug_A71 Phage 434 CRO protein; gene regulating protein, transcr 0.003
3kz3_A80 Repressor protein CI; five helix bundle, DNA-binding, t 7e-04
3omt_A73 Uncharacterized protein; structural genomics, PSI-2, pr 0.001
3op9_A114 PLI0006 protein; structural genomics, PSI-2, protein st 1e-05
1lmb_392 Protein (lambda repressor); protein-DNA complex, double 7e-04
3clc_A82 Regulatory protein; protein-DNA complex, transcriptiona 0.003
2p5t_A158 Putative transcriptional regulator PEZA; postsegregatio 2e-05
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCSG, pr 2e-07
3gn5_A133 HTH-type transcriptional regulator MQSA (YGIT/B3021); Z 3e-07
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; HTH- 3e-07
3cec_A104 Putative antidote protein of plasmid maintenance system 5e-06
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-turn-h 5e-05
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2, MCS 0.001
3fym_A130 Putative uncharacterized protein; HTH DNA binding, DNA 0.003
1b0n_A111 Protein (SINR protein); transcription regulator, antago 9e-04
2auw_A170 Hypothetical protein NE0471; alpha-beta structure, stru 6e-07
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Length = 99 Back     alignment and structure
 Score = 64.6 bits (157), Expect = 1e-11
 Identities = 23/92 (25%), Positives = 37/92 (40%), Gaps = 7/92 (7%)

Query: 114 IGARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTK--KHLDW 171
           I  ++  +RK + +S+ +   L G+P  TLS YE GR+ P       I Q  +  K+  W
Sbjct: 5   ISEKIVLMRKSEYLSRQQLADLTGVPYGTLSYYESGRSTPPTDVMMNILQTPQFTKYTLW 64

Query: 172 IYFGDEV-----IVPKSIKRAKGNQSSKKSKK 198
                       I P      +   +S  S +
Sbjct: 65  FMTNQIAPESGQIAPALAHFGQNETTSPHSGQ 96


>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 Length = 68 Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Length = 111 Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, structural genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Length = 141 Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Bacteriophage P22} SCOP: a.35.1.2 Length = 76 Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Length = 74 Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Length = 99 Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Length = 69 Back     alignment and structure
>2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, helix-turn-helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae TIGR4} Length = 158 Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Length = 192 Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile 630} Length = 126 Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Length = 77 Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, bacterial persistence, serine kinase, mercury derivative, SAD; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Length = 88 Back     alignment and structure
>2jvl_A TRMBF1; coactivator, helix-turn-helix, protein binding, transcription; NMR {Trichoderma reesei} Length = 107 Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Length = 71 Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 Length = 111 Back     alignment and structure
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Length = 73 Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Length = 91 Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A Length = 198 Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Length = 80 Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Length = 73 Back     alignment and structure
>1utx_A CYLR2; DNA-binding protein, transcriptional repressor, regulation of cytolysin operon, helix-turn-helix; 1.90A {Enterococcus faecalis} SCOP: a.35.1.3 PDB: 2gzu_A Length = 66 Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response element family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Length = 83 Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Length = 114 Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Length = 92 Back     alignment and structure
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Length = 236 Back     alignment and structure
>3clc_A Regulatory protein; protein-DNA complex, transcriptional regulator, helix-turn- helix, DNA-bending, plasmid, transcription regulator/DNA complex; 2.80A {Enterobacter SP} Length = 82 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovarisraelensis atcc 35646} Length = 293 Back     alignment and structure
>2wus_R RODZ, putative uncharacterized protein; structural protein, cell WALL morphogenesis, bacterial cytos bacterial actin; 2.90A {Thermotoga maritima} Length = 112 Back     alignment and structure
>2awi_A PRGX; repressor, pheromone, DNA binding, regulatory domain, transcription; 2.25A {Enterococcus faecalis} SCOP: a.35.1.11 a.118.8.4 PDB: 2axv_A 2axu_A 2aw6_A 2axz_A 2grl_A 2grm_A Length = 317 Back     alignment and structure
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Length = 99 Back     alignment and structure
>3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A Length = 443 Back     alignment and structure
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Length = 99 Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 Length = 68 Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Length = 111 Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, structural genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Length = 141 Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Bacteriophage P22} SCOP: a.35.1.2 Length = 76 Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Length = 74 Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Length = 69 Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Length = 192 Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile 630} Length = 126 Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Length = 77 Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, bacterial persistence, serine kinase, mercury derivative, SAD; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Length = 88 Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Length = 71 Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Length = 80 Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Length = 73 Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Length = 114 Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Length = 92 Back     alignment and structure
>3clc_A Regulatory protein; protein-DNA complex, transcriptional regulator, helix-turn- helix, DNA-bending, plasmid, transcription regulator/DNA complex; 2.80A {Enterobacter SP} Length = 82 Back     alignment and structure
>2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, helix-turn-helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae TIGR4} Length = 158 Back     alignment and structure
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomics; 1.80A {Silicibacter pomeroyi} Length = 86 Back     alignment and structure
>3gn5_A HTH-type transcriptional regulator MQSA (YGIT/B3021); Zn-binding protein, HTH-XRE DNA binding motif, DNA-binding, transcription regulation; HET: MEQ; 2.15A {Escherichia coli k-12} PDB: 3gn5_B* Length = 133 Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* Length = 133 Back     alignment and structure
>3cec_A Putative antidote protein of plasmid maintenance system; ZP_00107635.1, structural genomics, joint center for structural genomics; HET: MSE; 1.60A {Nostoc punctiforme pcc 73102} Length = 104 Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Length = 84 Back     alignment and structure
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Length = 78 Back     alignment and structure
>3fym_A Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp} Length = 130 Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 Length = 111 Back     alignment and structure
>2auw_A Hypothetical protein NE0471; alpha-beta structure, structural genomics, PSI, protein structure initiative; 1.85A {Nitrosomonas europaea} SCOP: a.35.1.10 d.331.1.1 Length = 170 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 hypothetical protein CLIBASIA_05625 [Candidatus Liberib
3op9_A114 PLI0006 protein; structural genomics, PSI-2, protein st 99.69
3ivp_A126 Putative transposon-related DNA-binding protein; APC626 99.69
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-binding dom 99.65
1y9q_A192 Transcriptional regulator, HTH_3 family; transcriptiona 99.64
1b0n_A111 Protein (SINR protein); transcription regulator, antago 99.63
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-turn-h 99.61
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-dependant 99.61
3mlf_A111 Transcriptional regulator; structural genomics, helix-t 99.6
1adr_A76 P22 C2 repressor; transcription regulation; NMR {Entero 99.6
3f52_A117 CLP gene regulator (CLGR); helix-turn-helix motif, tran 99.58
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG, GFT 99.57
1zug_A71 Phage 434 CRO protein; gene regulating protein, transcr 99.57
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1.54A 99.57
1r69_A69 Repressor protein CI; gene regulating protein; 2.00A {P 99.55
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2, MCS 99.55
3bs3_A76 Putative DNA-binding protein; XRE-family, structural ge 99.55
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, transcri 99.55
1lmb_392 Protein (lambda repressor); protein-DNA complex, double 99.55
2p5t_A158 Putative transcriptional regulator PEZA; postsegregatio 99.54
3omt_A73 Uncharacterized protein; structural genomics, PSI-2, pr 99.54
3g5g_A99 Regulatory protein; transcriptional regulator, helix-tu 99.52
3clc_A82 Regulatory protein; protein-DNA complex, transcriptiona 99.52
3kz3_A80 Repressor protein CI; five helix bundle, DNA-binding, t 99.52
2ict_A94 Antitoxin HIGA; helix-turn-helix, structural genomics, 99.52
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA binding 99.51
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, DNA- 99.51
2ofy_A86 Putative XRE-family transcriptional regulator; transcri 99.51
3kxa_A141 NGO0477 protein, putative uncharacterized protein; NEW 99.5
1utx_A66 CYLR2; DNA-binding protein, transcriptional repressor, 99.49
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, Pro binding, tra 99.48
1x57_A91 Endothelial differentiation-related factor 1; HMBF1alph 99.46
2wiu_B88 HTH-type transcriptional regulator HIPB; transferase tr 99.46
3cec_A104 Putative antidote protein of plasmid maintenance system 99.45
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-turn-h 99.4
3bdn_A236 Lambda repressor; repressor, allostery; HET: DNA; 3.91A 99.38
2awi_A 317 PRGX; repressor, pheromone, DNA binding, regulatory dom 99.36
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCSG, pr 99.33
2a6c_A83 Helix-turn-helix motif; putative transcriptional regula 99.32
2qfc_A 293 PLCR protein; TPR, HTH, transcription regulation; 2.60A 99.3
2wus_R112 RODZ, putative uncharacterized protein; structural prot 99.23
2fjr_A189 Repressor protein CI; genetic switch, regulation, coope 99.19
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B3021); h 99.18
2eby_A113 Putative HTH-type transcriptional regulator YBAQ; hypot 99.13
3g7d_A443 PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic 99.01
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif 98.98
2o38_A120 Hypothetical protein; alpha-beta, helix-turn-helix, str 98.94
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; HTH- 98.91
3fym_A130 Putative uncharacterized protein; HTH DNA binding, DNA 98.86
2auw_A170 Hypothetical protein NE0471; alpha-beta structure, stru 98.52
3bd1_A79 CRO protein; transcription factor, helix-turn-helix, pr 96.33
2k9q_A77 Uncharacterized protein; all helix, helix-turn-helix, p 95.58
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription factor, 95.42
3kjx_A 344 Transcriptional regulator, LACI family; LACL family, pr 94.52
2ox6_A166 Hypothetical protein SO3848; structural genomics, PSI-2 93.46
2hsg_A 332 Glucose-resistance amylase regulator; CCPA, transcripti 93.44
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding protein, L 93.4
2w48_A 315 Sorbitol operon regulator; SORC, activator, repressor, 93.4
1neq_A74 DNA-binding protein NER; NMR {Enterobacteria phage MU} 93.28
3h5t_A 366 Transcriptional regulator, LACI family; DNA-dependent, 93.01
1qpz_A 340 PURA, protein (purine nucleotide synthesis repressor); 92.6
1jhg_A101 Trp operon repressor; complex (regulatory protein/pepti 91.84
2csf_A101 DNA-binding protein SATB2; CUT domain, special AT-rich 91.53
1rzs_A61 Antirepressor, regulatory protein CRO; helix-turn-helix 90.08
3ivp_A126 Putative transposon-related DNA-binding protein; APC626 99.61
3op9_A114 PLI0006 protein; structural genomics, PSI-2, protein st 99.6
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-turn-h 99.59
3mlf_A111 Transcriptional regulator; structural genomics, helix-t 99.57
1y9q_A192 Transcriptional regulator, HTH_3 family; transcriptiona 99.57
1adr_A76 P22 C2 repressor; transcription regulation; NMR {Entero 99.56
1b0n_A111 Protein (SINR protein); transcription regulator, antago 99.55
1r69_A69 Repressor protein CI; gene regulating protein; 2.00A {P 99.53
1zug_A71 Phage 434 CRO protein; gene regulating protein, transcr 99.53
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, Pro binding, tra 99.53
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-binding dom 99.52
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-dependant 99.51
3omt_A73 Uncharacterized protein; structural genomics, PSI-2, pr 99.51
3f52_A117 CLP gene regulator (CLGR); helix-turn-helix motif, tran 99.5
2p5t_A158 Putative transcriptional regulator PEZA; postsegregatio 99.5
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG, GFT 99.49
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2, MCS 99.48
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, transcri 99.47
3bs3_A76 Putative DNA-binding protein; XRE-family, structural ge 99.47
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1.54A 99.46
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, DNA- 99.46
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA binding 99.45
2ict_A94 Antitoxin HIGA; helix-turn-helix, structural genomics, 99.44
3cec_A104 Putative antidote protein of plasmid maintenance system 99.43
3kxa_A141 NGO0477 protein, putative uncharacterized protein; NEW 99.42
3g5g_A99 Regulatory protein; transcriptional regulator, helix-tu 99.42
1utx_A66 CYLR2; DNA-binding protein, transcriptional repressor, 99.41
3clc_A82 Regulatory protein; protein-DNA complex, transcriptiona 99.41
2wiu_B88 HTH-type transcriptional regulator HIPB; transferase tr 99.39
3kz3_A80 Repressor protein CI; five helix bundle, DNA-binding, t 99.37
1lmb_392 Protein (lambda repressor); protein-DNA complex, double 99.37
1x57_A91 Endothelial differentiation-related factor 1; HMBF1alph 99.35
2ofy_A86 Putative XRE-family transcriptional regulator; transcri 99.29
3bdn_A 236 Lambda repressor; repressor, allostery; HET: DNA; 3.91A 99.28
2awi_A 317 PRGX; repressor, pheromone, DNA binding, regulatory dom 99.26
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-turn-h 99.25
3fmy_A