254781227

254781227

hypothetical protein CLIBASIA_05670

GeneID in NCBI database:8210252Locus tag:CLIBASIA_05670
Protein GI in NCBI database:254781227Protein Accession:YP_003065640.1
Gene range:-(1226067, 1226273)Protein Length:68aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------
MNTVKLGVKHFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVISAFAKAIS
cccEEEHHHHHHHHHcccEEEEEEcccccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHcc
cccEEEcEEEcccccccccEEEEEcccccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHc
mntvklgvkhfdtrkrgrtteiradgwmkedntARLSVVVSVAGETTDEEKLREYKEFVISAFAKAIS
mntvklgvkhfdtrkrgrtteiradgwmkedntarlSVVVsvagettdeeklreyKEFVISAFAKAIS
MNTVKLGVKHFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVISAFAKAIS
****KLGVKHFDTRKR**TTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVISAFAKAI*
MNTVKLGVKHFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVISAFAKAIS
*NTVKLGVKHFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVISAFAKAIS
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTVKLGVKHFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVISAFAKAIS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target68 hypothetical protein CLIBASIA_05670 [Candidatus Liberib
31712069268 hypothetical protein SC1_gp175 [Liberibacter phage SC1] 1 1e-30
>gi|317120692|gb|ADV02515.1| hypothetical protein SC1_gp175 [Liberibacter phage SC1] Length = 68 Back     alignment and organism information
 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/68 (98%), Positives = 67/68 (98%)

Query: 1  MNTVKLGVKHFDTRKRGRTTEIRADGWMKEDNTARLSVVVSVAGETTDEEKLREYKEFVI 60
          MNTVKLGVKHFDTRKRGRTTEIRADGWMKEDN ARLSVVVSVAGETTDEEKLREYKEFVI
Sbjct: 1  MNTVKLGVKHFDTRKRGRTTEIRADGWMKEDNIARLSVVVSVAGETTDEEKLREYKEFVI 60

Query: 61 SAFAKAIS 68
          SAFAKAIS
Sbjct: 61 SAFAKAIS 68


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00