254781226

254781226

hypothetical protein CLIBASIA_05665

GeneID in NCBI database:8210251Locus tag:CLIBASIA_05665
Protein GI in NCBI database:254781226Protein Accession:YP_003065639.1
Gene range:-(1225660, 1226049)Protein Length:129aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKPIEELIYKRG
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHcc
cccEcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccHHHHHHccc
MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDKMREKARQSYRKLYskdswiapeepmgmtKAEIEALEREIARLKAKPIEELIYKRG
mgrkvltpeermlcrreykrryylknrdkilerrrrrylknkdkiresyhqyylknkdkyreykRRYYLKNRDKMREKARQSYRklyskdswiapeepmGMTKAEIEALEREIArlkakpieeliykrg
MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLknkdkyreykrryylknrDKMREKARQSYRKLYSKDSWIAPEEPMGMTKaeiealereiarlKAKPIEELIYKRG
******T*EERMLCRREYKRRYYL************************************************************KLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKPIEELIYKR*
MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKPIEELIYKRG
**RKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKPIEELIYKRG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPxxxxxxxxxxxxxxxxxxxxxPIEELIYKRG
MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKPIEELIYKRG
MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKYREYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKPIEELIYKRG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target129 hypothetical protein CLIBASIA_05665 [Candidatus Liberib
254780286 410 deoxyguanosinetriphosphate triphosphohydrolase-lik 0.038
>gi|254780286|ref|YP_003064699.1| deoxyguanosinetriphosphate triphosphohydrolase-like protein [Candidatus Liberibacter asiaticus str. psy62] Length = 410 Back     alignment
 Score = 28.5 bits (62), Expect = 0.038,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 13/61 (21%)

Query: 1  MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKY 60
          +GR  + PE+R L R E++R     +RD+++     R LK+K ++      ++ + +D Y
Sbjct: 25 LGR--MYPEKRSLTRSEFQR-----DRDRMIHTTAFRRLKDKTQV------FFHRQRDHY 71

Query: 61 R 61
          R
Sbjct: 72 R 72

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target129 hypothetical protein CLIBASIA_05665 [Candidatus Liberib
317120691129 hypothetical protein SC1_gp170 [Liberibacter phage SC1] 1 9e-61
317120733129 hypothetical protein SC2_gp170 [Liberibacter phage SC2] 1 3e-60
31512195731 hypothetical protein CKC_01035 [Candidatus Liberibacter 1 3e-04
157953109 340 hypothetical protein NY2A_B805R [Paramecium bursaria Ch 1 0.003
167044410 308 hypothetical protein ALOHA_HF4000APKG6D3ctg6g4 [uncultu 1 0.004
157953109 340 hypothetical protein NY2A_B805R [Paramecium bursaria Ch 2 3e-05
157953109 340 hypothetical protein NY2A_B805R [Paramecium bursaria Ch 2 3e-04
157953770 310 hypothetical protein AR158_C580L [Paramecium bursaria C 2 3e-04
>gi|317120691|gb|ADV02514.1| hypothetical protein SC1_gp170 [Liberibacter phage SC1] Length = 129 Back     alignment and organism information
 Score =  236 bits (601), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 126/129 (97%)

Query: 1   MGRKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIRESYHQYYLKNKDKY 60
           M RKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKI+E+ HQYYLKNKDKY
Sbjct: 1   MERKVLTPEERMLCRREYKRRYYLKNRDKILERRRRRYLKNKDKIKENNHQYYLKNKDKY 60

Query: 61  REYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKP 120
           REYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKP
Sbjct: 61  REYKRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALEREIARLKAKP 120

Query: 121 IEELIYKRG 129
           IEELIYK+ 
Sbjct: 121 IEELIYKKA 129


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|317120733|gb|ADV02555.1| hypothetical protein SC2_gp170 [Liberibacter phage SC2] Length = 129 Back     alignment and organism information
>gi|315121957|ref|YP_004062446.1| hypothetical protein CKC_01035 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 31 Back     alignment and organism information
>gi|157953109|ref|YP_001498001.1| hypothetical protein NY2A_B805R [Paramecium bursaria Chlorella virus NY2A] Length = 340 Back     alignment and organism information
>gi|167044410|gb|ABZ09087.1| hypothetical protein ALOHA_HF4000APKG6D3ctg6g4 [uncultured marine crenarchaeote HF4000_APKG6D3] Length = 308 Back     alignment and organism information
>gi|157953109|ref|YP_001498001.1| hypothetical protein NY2A_B805R [Paramecium bursaria Chlorella virus NY2A] Length = 340 Back     alignment and organism information
>gi|157953109|ref|YP_001498001.1| hypothetical protein NY2A_B805R [Paramecium bursaria Chlorella virus NY2A] Length = 340 Back     alignment and organism information
>gi|157953770|ref|YP_001498661.1| hypothetical protein AR158_C580L [Paramecium bursaria Chlorella virus AR158] Length = 310 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target129 hypothetical protein CLIBASIA_05665 [Candidatus Liberib
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 3e-04
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 39.2 bits (90), Expect = 3e-04
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 5/35 (14%)

Query: 73  DKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIE 107
           +K   K  Q+  KLY+ DS  AP   + + KA +E
Sbjct: 18  EKQALKKLQASLKLYADDS--AP--ALAI-KATME 47


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00