255764460

255764460

recombinase A

GeneID in NCBI database:8209172Locus tag:CLIBASIA_00385
Protein GI in NCBI database:255764460Protein Accession:YP_003064605.2
Gene range:-(80562, 81653)Protein Length:363aa
Gene description:recombinase A
COG prediction:[L] RecA/RadA recombinase
KEGG prediction:recA; recombinase A; K03553 recombination protein RecA
SEED prediction:RecA protein
Pathway involved in KEGG:Homologous recombination [PATH:las03440]
Subsystem involved in SEED:DNA repair system including RecA, MutS and a hypothetical protein;
DNA-replication;
DNA repair, bacterial RecFOR pathway;
DNA repair, bacterial UmuCD system
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---
MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNVE
cccccccccHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccccccHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHccccHHHEEEcccccHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccEEEEcccccccccccccccHHHHEEEEEEEEEEcccccccccccccEEEEEEEEccccccccEEEEEEEEcccccccccHHHHHHHccHHHHcccEEEEccEEEEHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
ccHHHHHccHHHHHHHHHHHHHHHHHcccccEEEccccccccccEEEEccccccHHHHccccccccccEEEEccccccccccHHHHHHHHHHHccccEEEEcHHHcccHHHHHHcccccHHHccccccccHHHHHHHHHHHHccccEEEEEEccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccEEccccccHHHHHccccccccEccccEEEEEEEccccccccccEEEEcccccccccccHHHccccccEEcccccEEccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHccccccccccccccccccccc
mdyrkemniVDKSKALEAALSQIQRVYGKgaimqlgsqgsifegievvssgslgldialgiggfpkgriveiygpessgktTLALHTIAQsqktggtcafvDAEHALDSIYARKLGVDlknllisqpdtgeQALEITDMLVRSGAVDIIVIDSvaaltpraeiegdmgeslpGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGvmfgspetttggnalkfyssvrldirrvgsikdkdsitgnqTRVKVVKNkmaspfkqvefDIMYGEGISFFGELIDLGVKasivdksgawfsfkgqrlgqgrensKIFLRENIEIAENIESLLRQNAGLVadsllqepaintkddadkddtdnve
mdyrkemnivdKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFgspetttggnalkfyssvrldirrvgsikdkdsitgnqtrvkvvknkmaspfKQVEFDIMYGEGISFFGELIDLGVKASIVDKSgawfsfkgqrlgqgrensKIFLRENIEIAENIESLLRQNAGLVADSllqepaintkddadkddtdnve
MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINtkddadkddtdNVE
******************ALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIESLLRQNA****************************
MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD**********
MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLL********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNVE
MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNVE
MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNVE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target363 recombinase A [Candidatus Liberibacter asiaticus str. p
254780334479 DNA repair protein RadA [Candidatus Liberibacter a 0.001
>gi|254780334|ref|YP_003064747.1| DNA repair protein RadA [Candidatus Liberibacter asiaticus str. psy62] Length = 479 Back     alignment
 Score = 35.4 bits (80), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 62  GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSI--YARKLGVDL 119
           GGF +G ++ + G    GK+TL + T A          +V  E A+  I   A++L    
Sbjct: 85  GGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTIN 144

Query: 120 KNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPG--MQAR 177
            ++ I+     E   +I   L+ +   D+++IDS+  L  +        ES PG  +Q R
Sbjct: 145 SSVYIAIETNVE---DIIATLITNEKPDLVIIDSIQTLWSQT------AESSPGTVIQVR 195

Query: 178 LMSQAL 183
              QA+
Sbjct: 196 TSVQAM 201

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target363 recombinase A [Candidatus Liberibacter asiaticus str. p
315122763348 recombinase A [Candidatus Liberibacter solanacearum CLs 1 0.0
163759602360 recombinase A [Hoeflea phototrophica DFL-43] Length = 3 1 1e-158
90420927357 RecA [Aurantimonas manganoxydans SI85-9A1] Length = 357 1 1e-158
86357938362 recombinase A [Rhizobium etli CFN 42] Length = 362 1 1e-157
114707287357 recombinase A [Fulvimarina pelagi HTCC2506] Length = 35 1 1e-157
90818648355 recombinase A [Ochrobactrum anthropi] Length = 355 1 1e-157
222148885362 recombinase A [Agrobacterium vitis S4] Length = 362 1 1e-157
195970165361 recombinase A [Sinorhizobium meliloti 1021] Length = 36 1 1e-157
150396733361 recombinase A [Sinorhizobium medicae WSM419] Length = 3 1 1e-157
325293276363 recombinase A [Agrobacterium sp. H13-3] Length = 363 1 1e-156
>gi|315122763|ref|YP_004063252.1| recombinase A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 348 Back     alignment and organism information
 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/346 (88%), Positives = 335/346 (96%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL+AALSQI+R+YGKG+IMQLGSQ SI EG+EVVSSGSLGLDIALGIGGFPKGRI
Sbjct: 1   MDKSKALDAALSQIERLYGKGSIMQLGSQSSISEGVEVVSSGSLGLDIALGIGGFPKGRI 60

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH IAQSQK GGTCAFVDAEHALDS+YARKLGVDLKNLLISQPDT
Sbjct: 61  VEIYGPESSGKTTLALHAIAQSQKAGGTCAFVDAEHALDSVYARKLGVDLKNLLISQPDT 120

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITDMLVRSGAVDIIV+DSVAALTPRAEIEGDMGESLPG+QARLMSQALRKLT S
Sbjct: 121 GEQALEITDMLVRSGAVDIIVVDSVAALTPRAEIEGDMGESLPGLQARLMSQALRKLTGS 180

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS CIL+FINQ+RMKIGVMFGSPETTTGGNALKFY+S+RLDIRR+G+IK+KD+I GNQ
Sbjct: 181 ISRSNCILIFINQIRMKIGVMFGSPETTTGGNALKFYASIRLDIRRIGAIKEKDAIVGNQ 240

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMASPFKQVEFDIMYGEGIS  GELIDLGVKASIVDKSGAWFS+KGQRLGQG
Sbjct: 241 TRVKVVKNKMASPFKQVEFDIMYGEGISRVGELIDLGVKASIVDKSGAWFSYKGQRLGQG 300

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           REN+K+FLR+N+E+A +I++LLRQNAGLV+D LLQEPAINT+DDA+
Sbjct: 301 RENAKVFLRDNVEVASDIDNLLRQNAGLVSDILLQEPAINTRDDAN 346


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163759602|ref|ZP_02166687.1| recombinase A [Hoeflea phototrophica DFL-43] Length = 360 Back     alignment and organism information
>gi|90420927|ref|ZP_01228832.1| RecA [Aurantimonas manganoxydans SI85-9A1] Length = 357 Back     alignment and organism information
>gi|86357938|ref|YP_469830.1| recombinase A [Rhizobium etli CFN 42] Length = 362 Back     alignment and organism information
>gi|114707287|ref|ZP_01440184.1| recombinase A [Fulvimarina pelagi HTCC2506] Length = 357 Back     alignment and organism information
>gi|90818648|emb|CAJ32629.1| recombinase A [Ochrobactrum anthropi] Length = 355 Back     alignment and organism information
>gi|222148885|ref|YP_002549842.1| recombinase A [Agrobacterium vitis S4] Length = 362 Back     alignment and organism information
>gi|195970165|ref|NP_385905.2| recombinase A [Sinorhizobium meliloti 1021] Length = 361 Back     alignment and organism information
>gi|150396733|ref|YP_001327200.1| recombinase A [Sinorhizobium medicae WSM419] Length = 361 Back     alignment and organism information
>gi|325293276|ref|YP_004279140.1| recombinase A [Agrobacterium sp. H13-3] Length = 363 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target363 recombinase A [Candidatus Liberibacter asiaticus str. p
PRK09354349 PRK09354, recA, recombinase A; Provisional 0.0
TIGR02012321 TIGR02012, tigrfam_recA, protein RecA 1e-159
cd00983325 cd00983, recA, RecA is a bacterial enzyme which has rol 1e-147
KOG1433326 KOG1433, KOG1433, KOG1433, DNA repair protein RAD51/RHP 4e-31
pfam00154322 pfam00154, RecA, recA bacterial DNA recombination prote 1e-170
PRK09519 790 PRK09519, recA, DNA recombination protein RecA; Reviewe 8e-93
COG0468279 COG0468, RecA, RecA/RadA recombinase [DNA replication, 6e-81
cd01393226 cd01393, recA_like, RecA is a bacterial enzyme which ha 2e-62
cd01123235 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B 6e-14
pfam06745231 pfam06745, KaiC, KaiC 6e-09
COG0467260 COG0467, RAD55, RecA-superfamily ATPases implicated in 9e-08
PTZ00035337 PTZ00035, PTZ00035, Rad51 protein; Provisional 2e-06
PRK09519790 PRK09519, recA, DNA recombination protein RecA; Reviewe 3e-20
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 1e-13
PRK09361225 PRK09361, radB, DNA repair and recombination protein Ra 9e-11
cd01394218 cd01394, radB, RadB 2e-10
TIGR02237209 TIGR02237, recomb_radB, DNA repair and recombination pr 7e-10
PLN03187344 PLN03187, PLN03187, meiotic recombination protein DMC1 2e-09
PRK04301317 PRK04301, radA, DNA repair and recombination protein Ra 4e-08
smart00382148 smart00382, AAA, ATPases associated with a variety of c 1e-07
TIGR02238313 TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 5e-07
pfam08423261 pfam08423, Rad51, Rad51 1e-06
TIGR02239316 TIGR02239, recomb_RAD51, DNA repair protein RAD51 6e-06
KOG1434335 KOG1434, KOG1434, KOG1434, Meiotic recombination protei 1e-05
PLN03186342 PLN03186, PLN03186, DNA repair protein RAD51 homolog; P 1e-05
TIGR02236310 TIGR02236, recomb_radA, DNA repair and recombination pr 4e-05
TIGR03880224 TIGR03880, KaiC_arch_3, KaiC domain protein, AF_0351 fa 4e-07
cd01121372 cd01121, Sms, Sms (bacterial radA) DNA repair protein 4e-06
COG1066456 COG1066, Sms, Predicted ATP-dependent serine protease [ 8e-06
TIGR03881229 TIGR03881, KaiC_arch_4, KaiC domain protein, PAE1156 fa 1e-05
TIGR00416454 TIGR00416, sms, DNA repair protein RadA 6e-04
PRK09302509 PRK09302, PRK09302, circadian clock protein KaiC; Revie 6e-04
PRK11823446 PRK11823, PRK11823, DNA repair protein RadA; Provisiona 0.001
KOG1564351 KOG1564, KOG1564, KOG1564, DNA repair protein RHP57 [Re 5e-06
>gnl|CDD|181793 PRK09354, recA, recombinase A; Provisional Back     alignment and domain information
>gnl|CDD|162659 TIGR02012, tigrfam_recA, protein RecA Back     alignment and domain information
>gnl|CDD|29984 cd00983, recA, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>gnl|CDD|36646 KOG1433, KOG1433, KOG1433, DNA repair protein RAD51/RHP55 [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|143922 pfam00154, RecA, recA bacterial DNA recombination protein Back     alignment and domain information
>gnl|CDD|77219 PRK09519, recA, DNA recombination protein RecA; Reviewed Back     alignment and domain information
>gnl|CDD|30816 COG0468, RecA, RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|30003 cd01393, recA_like, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>gnl|CDD|29989 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B Back     alignment and domain information
>gnl|CDD|148381 pfam06745, KaiC, KaiC Back     alignment and domain information
>gnl|CDD|30815 COG0467, RAD55, RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185407 PTZ00035, PTZ00035, Rad51 protein; Provisional Back     alignment and domain information
>gnl|CDD|77219 PRK09519, recA, DNA recombination protein RecA; Reviewed Back     alignment and domain information
>gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|181799 PRK09361, radB, DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>gnl|CDD|30004 cd01394, radB, RadB Back     alignment and domain information
>gnl|CDD|162777 TIGR02237, recomb_radB, DNA repair and recombination protein RadB Back     alignment and domain information
>gnl|CDD|178729 PLN03187, PLN03187, meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>gnl|CDD|179814 PRK04301, radA, DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|131292 TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 Back     alignment and domain information
>gnl|CDD|117002 pfam08423, Rad51, Rad51 Back     alignment and domain information
>gnl|CDD|162778 TIGR02239, recomb_RAD51, DNA repair protein RAD51 Back     alignment and domain information
>gnl|CDD|36647 KOG1434, KOG1434, KOG1434, Meiotic recombination protein Dmc1 [Energy production and conversion, Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|178728 PLN03186, PLN03186, DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>gnl|CDD|131290 TIGR02236, recomb_radA, DNA repair and recombination protein RadA Back     alignment and domain information
>gnl|CDD|163592 TIGR03880, KaiC_arch_3, KaiC domain protein, AF_0351 family Back     alignment and domain information
>gnl|CDD|29987 cd01121, Sms, Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>gnl|CDD|31265 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163593 TIGR03881, KaiC_arch_4, KaiC domain protein, PAE1156 family Back     alignment and domain information
>gnl|CDD|161868 TIGR00416, sms, DNA repair protein RadA Back     alignment and domain information
>gnl|CDD|181771 PRK09302, PRK09302, circadian clock protein KaiC; Reviewed Back     alignment and domain information
>gnl|CDD|183326 PRK11823, PRK11823, DNA repair protein RadA; Provisional Back     alignment and domain information
>gnl|CDD|36777 KOG1564, KOG1564, KOG1564, DNA repair protein RHP57 [Replication, recombination and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 363 recombinase A [Candidatus Liberibacter asiaticus str. p
PRK09354350 recA recombinase A; Provisional 100.0
TIGR02012322 tigrfam_recA protein RecA; InterPro: IPR001553 The recA 100.0
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 100.0
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 100.0
KOG1433326 consensus 99.91
PRK09519790 recA recombinase A; Reviewed 99.81
PRK09519 790 recA recombinase A; Reviewed 100.0
PRK04301318 radA DNA repair and recombination protein RadA; Validat 100.0
TIGR02236333 recomb_radA DNA repair and recombination protein RadA; 100.0
PTZ00035350 Rad51; Provisional 100.0
TIGR02238314 recomb_DMC1 meiotic recombinase Dmc1; InterPro: IPR0119 100.0
COG0305435 DnaB Replicative DNA helicase [DNA replication, recombi 99.27
TIGR00665465 DnaB replicative DNA helicase; InterPro: IPR007692 This 96.55
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 100.0
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 100.0
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 100.0
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 100.0
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 100.0
cd01394218 radB RadB. The archaeal protein radB shares similarity 100.0
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 100.0
KOG1434335 consensus 100.0
TIGR02239317 recomb_RAD51 DNA repair protein RAD51; InterPro: IPR011 99.94
KOG1564351 consensus 99.93
PRK04328250 hypothetical protein; Provisional 99.9
KOG1433326 consensus 99.9
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 99.89
pfam06745231 KaiC KaiC. This family represents a conserved region wi 99.88
PRK09302501 circadian clock protein KaiC; Reviewed 99.88
PRK06067241 flagellar accessory protein FlaH; Validated 99.88
PRK11823454 DNA repair protein RadA; Provisional 99.88
PRK08533230 flagellar accessory protein FlaH; Reviewed 99.77
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 99.73
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 99.71
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 99.7
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 99.64
PRK08760476 replicative DNA helicase; Provisional 99.59
PRK05748448 replicative DNA helicase; Provisional 99.59
PRK07004460 replicative DNA helicase; Provisional 99.58
PRK05595444 replicative DNA helicase; Provisional 99.58
PRK05636507 replicative DNA helicase; Provisional 99.58
PRK07263453 consensus 99.58
PRK09165484 replicative DNA helicase; Provisional 99.58
cd01124187 KaiC KaiC is a circadian clock protein primarily found 99.57
PRK08840464 replicative DNA helicase; Provisional 99.56
PRK08082453 consensus 99.56
PRK08006471 replicative DNA helicase; Provisional 99.54
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 99.53
PRK08694468 consensus 99.52
PRK06749428 replicative DNA helicase; Provisional 99.52
PRK06904472 replicative DNA helicase; Validated 99.5
PRK08506473 replicative DNA helicase; Provisional 99.47
PRK06321472 replicative DNA helicase; Provisional 99.46
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 99.15
COG4544260 Uncharacterized conserved protein [Function unknown] 98.34
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 97.74
TIGR02545439 ATP_syn_fliI flagellar protein export ATPase FliI; Inte 97.61
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 96.17
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA mismat 95.59
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS prot 95.54
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 99.86
smart00382148 AAA ATPases associated with a variety of cellular activ 98.72
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.99
PRK12377248 putative replication protein; Provisional 97.9
PRK08181269 transposase; Validated 97.84
PRK06526254 transposase; Provisional 97.82
PRK09183258 transposase/IS protein; Provisional 97.73
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 97.72
PRK07952242 DNA replication protein DnaC; Validated 97.69
PRK08116262 hypothetical protein; Validated 97.62
PRK06835330 DNA replication protein DnaC; Validated 97.59
COG1484254 DnaC DNA replication protein [DNA replication, recombin 97.53
PRK11519720 tyrosine kinase; Provisional 97.47
COG0056504 AtpA F0F1-type ATP synthase, alpha subunit [Energy prod 97.45
COG4608268 AppF ABC-type oligopeptide transport system, ATPase com 97.23
KOG0744423 consensus 97.22
KOG0735 952 consensus 97.04
COG1435201 Tdk Thymidine kinase [Nucleotide transport and metaboli 96.68
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 95.86
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 99.85
TIGR00416481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 99.73
TIGR01026455 fliI_yscN ATPase FliI/YscN family; InterPro: IPR005714 97.18
PTZ00185574 ATPase alpha subunit; Provisional 95.78
PRK09302 501 circadian clock protein KaiC; Reviewed 99.82
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 99.59
PRK07773 868 replicative DNA helicase; Validated 99.31
TIGR02655 484 circ_KaiC circadian clock protein KaiC; InterPro: IPR01 98.62
KOG2859293 consensus 98.43
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 98.28
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 98.19
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 98.06
PRK03992390 proteasome-activating nucleotidase; Provisional 98.04
COG2087175 CobU Adenosyl cobinamide kinase/adenosyl cobinamide pho 98.03
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 98.03
TIGR02655484 circ_KaiC circadian clock protein KaiC; InterPro: IPR01 98.0
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 97.88
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 97.86
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 97.85
CHL00060480 atpB ATP synthase CF1 beta subunit 97.77
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta. 97.75
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 97.72
PRK09280466 F0F1 ATP synthase subunit beta; Validated 97.71
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 97.67
KOG0730 693 consensus 97.66
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 97.64
PRK07165507 F0F1 ATP synthase subunit alpha; Validated 97.63
TIGR00959439 ffh signal recognition particle protein; InterPro: IPR0 97.54
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 97.52
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 97.46
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 97.45
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 97.42
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 97.41
KOG0733802 consensus 97.35
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 97.34
PTZ00243 1560 ABC transporter; Provisional 97.32
CHL00195491 ycf46 Ycf46; Provisional 97.29
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 97.28
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 97.2
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 97.18
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 97.16
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 97.14
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 97.08
KOG0735952 consensus 97.02
KOG0054 1381 consensus 96.92
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 96.91
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 96.82
PRK02118432 V-type ATP synthase subunit B; Provisional 96.72
PRK06921265 hypothetical protein; Provisional 96.62
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 96.62
PHA00520326 packaging NTPase P4 96.61
KOG0727408 consensus 96.51
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 96.48
PRK04196460 V-type ATP synthase subunit B; Provisional 96.47
COG0410237 LivF ABC-type branched-chain amino acid transport syste 96.34
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 96.16
PRK06761281 hypothetical protein; Provisional 95.89
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 95.79
KOG2373514 consensus 95.75
PRK11147632 ABC transporter ATPase component; Reviewed 95.61
KOG0730693 consensus 95.58
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein 95.46
KOG0652424 consensus 95.39
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS prot 95.39
PRK05973237 replicative DNA helicase; Provisional 98.86
KOG0736953 consensus 97.66
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 98.31
CHL00059501 atpA ATP synthase CF1 alpha subunit 98.19
cd03115173 SRP The signal recognition particle (SRP) mediates the 98.17
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 98.14
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central domain. 98.13
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 98.12
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 98.07
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha. 98.05
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide 98.0
PRK06315442 type III secretion system ATPase; Provisional 97.98
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 97.95
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.93
PRK06793432 fliI flagellum-specific ATP synthase; Validated 97.93
PRK12597459 F0F1 ATP synthase subunit beta; Provisional 97.85
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. Membe 97.81
PRK07960455 fliI flagellum-specific ATP synthase; Validated 97.8
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-specific 97.79
PRK00771433 signal recognition particle protein Srp54; Provisional 97.78
PRK10867453 signal recognition particle protein; Provisional 97.77
PRK07594433 type III secretion system ATPase; Validated 97.75
PRK08927441 fliI flagellum-specific ATP synthase; Validated 97.75
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 97.75
PRK08149427 ATP synthase SpaL; Validated 97.74
PRK06002450 fliI flagellum-specific ATP synthase; Validated 97.74
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.73
PRK07721435 fliI flagellum-specific ATP synthase; Validated 97.7
PRK10416499 cell division protein FtsY; Provisional 97.69
PRK05922434 type III secretion system ATPase; Validated 97.68
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 97.68
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 97.66
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. Membe 97.66
PRK07196434 fliI flagellum-specific ATP synthase; Validated 97.63
PRK09099441 type III secretion system ATPase; Provisional 97.63
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 97.63
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.62
PRK08084235 DNA replication initiation factor; Provisional 97.62
PRK08472435 fliI flagellum-specific ATP synthase; Validated 97.62
PRK13849231 putative crown gall tumor protein VirC1; Provisional 97.61
KOG0780483 consensus 97.6
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t 97.59
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 97.58
PRK06936439 type III secretion system ATPase; Provisional 97.56
COG1157441 FliI Flagellar biosynthesis/type III secretory pathway 97.55
TIGR02546430 III_secr_ATP type III secretion apparatus H+-transporti 97.55
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 97.55
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 97.53
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. Membe 97.53
PRK12422455 chromosomal replication initiation protein; Provisional 97.53
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subu 97.52
PRK05688451 fliI flagellum-specific ATP synthase; Validated 97.51
cd03246173 ABCC_Protease_Secretion This family represents the ABC 97.51
PRK08972440 fliI flagellum-specific ATP synthase; Validated 97.5
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 97.5
PRK06893229 DNA replication initiation factor; Validated 97.49
cd03234226 ABCG_White The White subfamily represents ABC transport 97.46
PRK08903227 hypothetical protein; Validated 97.45
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 97.45
PRK05642234 DNA replication initiation factor; Validated 97.45
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 97.44
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.43
cd01128249 rho_factor Transcription termination factor rho is a ba 97.43
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.43
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 97.42
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 97.41
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.4
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.35
PRK06820445 type III secretion system ATPase; Validated 97.33
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 97.31
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.29
cd03114148 ArgK-like The function of this protein family is unkown 97.26
PRK08727233 hypothetical protein; Validated 97.25
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 97.23
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 97.22
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 97.21
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 97.18
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 97.18
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 97.13
PRK13341 726 recombination factor protein RarA/unknown domain fusion 97.13
PHA02518211 ParA-like protein; Provisional 97.07
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 97.06
PRK03846198 adenylylsulfate kinase; Provisional 97.04
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.04
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 97.03
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A. 97.03
PRK00149447 dnaA chromosomal replication initiation protein; Review 97.02
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 97.0
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 96.99
COG4555245 NatA ABC-type Na+ transport system, ATPase component [E 96.95
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 96.93
PRK08939306 primosomal protein DnaI; Reviewed 96.88
PRK05541176 adenylylsulfate kinase; Provisional 96.88
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 96.88
PRK08233182 hypothetical protein; Provisional 96.86
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 96.83
pfam00308219 Bac_DnaA Bacterial dnaA protein. 96.83
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 96.83
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 96.82
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 96.82
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 96.81
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 96.81
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 96.77
PRK10790593 putative multidrug transporter membrane\ATP-binding com 96.72
pfam00931285 NB-ARC NB-ARC domain. 96.7
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 96.69
PRK00889175 adenylylsulfate kinase; Provisional 96.66
KOG0734752 consensus 96.61
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 96.53
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 96.49
KOG3928461 consensus 96.48
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 96.46
PRK12608379 transcription termination factor Rho; Provisional 96.45
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 96.4
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 96.39
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.38
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.37
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 96.37
PRK00440318 rfc replication factor C small subunit; Reviewed 96.33
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 96.33
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.28
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 96.27
PRK04296197 thymidine kinase; Provisional 96.27
PRK09435325 arginine/ornithine transport system ATPase; Provisional 96.26
PRK09376416 rho transcription termination factor Rho; Provisional 96.25
PRK09112352 DNA polymerase III subunit delta'; Validated 96.21
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 96.18
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 96.13
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 96.09
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.06
PRK05986190 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 96.06
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 96.02
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 96.01
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 95.94
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.94
KOG3062281 consensus 95.94
PRK07471363 DNA polymerase III subunit delta'; Validated 95.92
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 95.76
PRK05506 613 bifunctional sulfate adenylyltransferase subunit 1/aden 95.75
cd02034116 CooC The accessory protein CooC, which contains a nucle 95.72
COG2894272 MinD Septum formation inhibitor-activating ATPase [Cell 95.68
COG1204 766 Superfamily II helicase [General function prediction on 95.67
pfam10236274 DAP3 Mitochondrial ribosomal death-associated protein 3 95.6
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 95.49
COG4559259 ABC-type hemin transport system, ATPase component [Inor 95.49
PRK12678667 transcription termination factor Rho; Provisional 95.39
KOG0733 802 consensus 98.24
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 97.76
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 97.76
PRK04195403 replication factor C large subunit; Provisional 97.74
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 97.68
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 97.64
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 97.63
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.56
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 97.55
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 97.54
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 97.52
CHL00176 631 ftsH cell division protein; Validated 97.52
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 97.52
TIGR01526346 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 97.49
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 97.49
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 97.46
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 97.44
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 97.42
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 97.41
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 97.4
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.4
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 97.36
COG1123 539 ATPase components of various ABC-type transport systems 97.36
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.36
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 97.35
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 97.35
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 97.33
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 97.32
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 97.31
pfam05625353 PAXNEB PAXNEB protein. PAXNEB or PAX6 neighbour is foun 97.27
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 97.26
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 97.26
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 97.26
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.24
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 97.23
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 97.23
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 97.22
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.19
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.19
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 97.18
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.18
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 97.17
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 97.17
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 97.16
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 97.15
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.14
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 97.11
PRK10522547 multidrug transporter membrane component/ATP-binding co 97.08
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.08
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 97.07
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 97.07
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 97.06
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 97.06
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 97.06
PRK10908222 cell division protein FtsE; Provisional 97.06
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 97.04
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 97.03
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 97.02
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 97.02
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 97.0
PRK13695174 putative NTPase; Provisional 97.0
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 96.99
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 96.99
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 96.98
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 96.98
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 96.97
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 96.97
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 96.97
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 96.95
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 96.94
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 96.93
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 96.93
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 96.93
PRK13536306 nodulation factor exporter subunit NodI; Provisional 96.92
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 96.92
PRK13768253 GTPase; Provisional 96.9
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 96.89
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 96.86
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 96.82
KOG0731 774 consensus 96.81
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 96.81
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 96.8
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 96.79
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 96.78
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 96.78
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 96.77
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 96.77
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 96.75
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 96.75
COG4172 534 ABC-type uncharacterized transport system, duplicated A 96.75
cd02040270 NifH NifH gene encodes component II (iron protein) of n 96.73
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 96.72
pfam01656212 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. Thi 96.72
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 96.71
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 96.7
PRK11147 632 ABC transporter ATPase component; Reviewed 96.67
TIGR00929 931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 96.63
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 96.62
COG3172187 NadR Predicted ATPase/kinase involved in NAD metabolism 96.6
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 96.58
PRK08099411 nicotinamide-nucleotide adenylyltransferase; Provisiona 96.58
KOG3949360 consensus 96.58
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 96.55
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 96.54
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 96.49
PRK13342417 recombination factor protein RarA; Reviewed 96.49
PRK10818270 cell division inhibitor MinD; Provisional 96.49
cd02117212 NifH_like This family contains the NifH (iron protein) 96.49
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 96.43
cd02042104 ParA ParA and ParB of Caulobacter crescentus belong to 96.42
PRK10982 491 galactose/methyl galaxtoside transporter ATP-binding pr 96.4
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 96.39
PRK05580 699 primosome assembly protein PriA; Validated 96.39
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 96.38
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 96.33
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 96.33
PRK12402337 replication factor C small subunit 2; Reviewed 96.29
COG1341398 Predicted GTPase or GTP-binding protein [General functi 96.29
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 96.26
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 96.25
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 96.25
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 96.24
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 96.19
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 96.13
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 96.08
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 96.07
PRK07667190 uridine kinase; Provisional 96.07
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 96.07
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 96.07
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 96.02
PRK00635 1809 excinuclease ABC subunit A; Provisional 96.0
PRK06696227 uridine kinase; Validated 95.95
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 95.95
PRK09984262 phosphonate/organophosphate ester transporter subunit; 95.88
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 95.87
KOG1969 877 consensus 95.85
TIGR02142361 modC_ABC molybdate ABC transporter, ATP-binding protein 95.82
COG3839338 MalK ABC-type sugar transport systems, ATPase component 95.79
cd02032267 Bchl_like This family of proteins contains bchL and chl 95.69
KOG1533290 consensus 95.68
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 95.65
PRK00635 1809 excinuclease ABC subunit A; Provisional 95.61
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 95.59
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 95.59
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.58
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.55
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 95.51
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 95.5
PRK13891852 conjugal transfer protein TrbE; Provisional 95.43
TIGR00630956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 95.39
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 98.0
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.58
pfam00004131 AAA ATPase family associated with various cellular acti 97.41
pfam03266168 DUF265 Protein of unknown function, DUF265. 96.96
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.67
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.63
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.57
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.53
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 97.53
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.52
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.5
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 97.48
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 97.46
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 97.39
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.37
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.37
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.36
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 97.32
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 97.29
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 97.26
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 97.25
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 97.23
PRK13544208 consensus 97.2
COG1129 500 MglA ABC-type sugar transport system, ATPase component 97.2
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 97.13
PRK13542224 consensus 97.02
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 96.98
PRK13830818 conjugal transfer protein TrbE; Provisional 96.74
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 96.74
COG3451796 VirB4 Type IV secretory pathway, VirB4 components [Intr 96.68
PRK13898800 type IV secretion system ATPase VirB4; Provisional 96.65
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 96.64
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 96.56
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 96.18
PRK13873815 conjugal transfer ATPase TrbE; Provisional 96.14
PRK13853789 type IV secretion system protein VirB4; Provisional 96.11
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 96.1
PRK13721864 conjugal transfer ATP-binding protein TraC; Provisional 95.99
KOG0055 1228 consensus 95.93
COG1118345 CysA ABC-type sulfate/molybdate transport systems, ATPa 95.9
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 95.85
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 95.81
COG0411250 LivG ABC-type branched-chain amino acid transport syste 95.77
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 95.77
COG4604252 CeuD ABC-type enterochelin transport system, ATPase com 95.74
TIGR01184230 ntrCD nitrate ABC transporter, ATP-binding proteins C a 95.7
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 95.7
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 95.54
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.52
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.41
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.4
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.4
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 97.3
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 96.91
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 97.29
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 96.04
CHL00181287 cbbX CbbX; Provisional 95.84
COG3845 501 ABC-type uncharacterized transport systems, ATPase comp 97.1
KOG0739439 consensus 96.67
TIGR01425453 SRP54_euk signal recognition particle protein SRP54; In 96.91
pfam09818447 ABC_ATPase Predicted ATPase of the ABC class. Members o 96.16
COG1123 539 ATPase components of various ABC-type transport systems 96.89
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA; InterPro: IPR001553 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>pfam00154 RecA recA bacterial DNA recombination protein Back     alignment and domain information
>KOG1433 consensus Back     alignment and domain information
>PRK09519 recA recombinase A; Reviewed Back     alignment and domain information
>PRK09519 recA recombinase A; Reviewed Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA; InterPro: IPR011938 This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA, eukaryotic RAD51 (IPR011941 from INTERPRO), and archaeal RadB (IPR011939 from INTERPRO) Back     alignment and domain information
>PTZ00035 Rad51; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1; InterPro: IPR011940 This entry describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins Back     alignment and domain information
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase; InterPro: IPR007692 This family includes the replicative DNA helicases, helicase DnaB, which exhibit DNA-dependent ATPase activity Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>pfam08423 Rad51 Rad51 Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB; InterPro: IPR011939 This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA, eukaryotic RAD51 (IPR011941 from INTERPRO) and DMC1 (IPR011940 from INTERPRO), and archaeal RadA (IPR011938 from INTERPRO) ,, Back     alignment and domain information
>KOG1434 consensus Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51; InterPro: IPR011941 Homologous recombination is an evolutionarily conserved mechanism for the repair of double-strand breaks in DNA and the generation of genetic diversity Back     alignment and domain information
>KOG1564 consensus Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>KOG1433 consensus Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>pfam06745 KaiC KaiC Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information