255764462

255764462

methionyl-tRNA formyltransferase

GeneID in NCBI database:8209278Locus tag:CLIBASIA_00905
Protein GI in NCBI database:255764462Protein Accession:YP_003064709.2
Gene range:-(186224, 187156)Protein Length:310aa
Gene description:methionyl-tRNA formyltransferase
COG prediction:[J] Methionyl-tRNA formyltransferase
KEGG prediction:fmt; methionyl-tRNA formyltransferase (EC:2.1.2.9); K00604 methionyl-tRNA formyltransferase [EC:2.1.2.9]
SEED prediction:Methionyl-tRNA formyltransferase (EC 2.1.2.9)
Pathway involved in KEGG:One carbon pool by folate [PATH:las00670]
Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:Translation initiation factors bacterial;
Conserved gene cluster associated with Met-tRNA formyltransferase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MTLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPALVPTKLGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMMIGNKHERIKLLESQLVEGEGKPGEVINPNFTIACSQGAVRIMRLQRAGGRVLDIGDFLLGCPVIIGCIVG
ccEEEEEEEccHHHHHHHHHHHHccccEEEEEEccccHHHcccccccccHHHHHHHHHcccEEccccccHHHHHHHHHccccEEEEEcccccccHHHHHHccccEEEEccccccccccccHHHHHHHccccEEEEEEEEEccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHcEEcccccHHHHHHHHcccccccEEEEEEEcccccEEEEEEEEEEccccccccEEEEccEEEEEcccEEEEEEEEccccccccHHHHHcccccccccccc
cccEEEEEEccHHHHHHHHHHHHcccEEEEEEccccEccccccccccccHHHHHHHHccccccccccccHHHHHHHHHccccEEEEEcccccccHHHHHcccccEEEEEcccccccEcccHHHHHHHHcccEEEEEEEEcccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEcccHHHccEcccccHHHHEcccccEHHHHHHHHHHccccccEEEEEEcccccEEEEEEEEEEccccccccEEEcccEEEEccccEEEEEEccccccccccHHHHHcccccccccEcc
MTLRVVFMGTSEFAVATLQALVSSshsivsvytqpprpagrrgLKSVLSAVHKKaqefslpalvptklgqEEYEQFLSFNADVAVVVAYGLVIPQRILNAtklgfynghasllprwrgaapiqraimagdnETGIAIMKMdkhldtgpvafmrkvpissnintaGLQQELSVLCAHAMVEAMDKLeqnnlplspqiengITYAEKISKGETRVNFCRSAENVHNHiralspfpgaWLEMMIGNKHERIKLLESQlvegegkpgevinpnftiACSQGAVRIMRLQRaggrvldigdfllgcpviigcivg
MTLRVVFMGTSEFAVATLQALVSSSHSIVSVYtqpprpagrRGLKSVLSAVHKKAqefslpalvpTKLGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMMIGNKHERIKLLESQLVEGegkpgevinpnfTIACSQGAVRIMRLQRAGGRVLDIGDFLLGCPVIIGCIVG
MTLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPALVPTKLGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMMIGNKHERIKLLESQLVEGEGKPGEVINPNFTIACSQGAVRIMRLQRAGGRVLDIGDFLLGCPVIIGCIVG
MTLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPALVPTKLGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMMIGNKHERIKLLESQLVEGEGKPGEVINPNFTIACSQGAVRIMRLQRAGGRVLDIGDFLLGCPVIIGCIVG
MTLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPALVPTKLGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMMIGNKHERIKLLESQLVEGEGKPGEVINPNFTIACSQGAVRIMRLQRAGGRVLDIGDFLLGCPVIIGCIVG
*TLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPALVPTKLGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMMIGNKHERIKLLESQLVEGEGKPGEVINPNFTIACSQGAVRIMRLQRAGGRVLDIGD**LGCPVII***V*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPALVPTKLGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMMIGNKHERIKLLESQLVEGEGKPGEVINPNFTIACSQGAVRIMRLQRAGGRVLDIGDFLLGCPVIIGCIVG
MTLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPALVPTKLGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMMIGNKHERIKLLESQLVEGEGKPGEVINPNFTIACSQGAVRIMRLQRAGGRVLDIGDFLLGCPVIIGCIVG
MTLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPALVPTKLGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMMIGNKHERIKLLESQLVEGEGKPGEVINPNFTIACSQGAVRIMRLQRAGGRVLDIGDFLLGCPVIIGCIVG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target310 methionyl-tRNA formyltransferase [Candidatus Liberibact
254780570205 phosphoribosylglycinamide formyltransferase [Candi 1e-06
254780911288 formyltetrahydrofolate deformylase [Candidatus Lib 0.011
>gi|254780570|ref|YP_003064983.1| phosphoribosylglycinamide formyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Back     alignment
 Score = 45.1 bits (105), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 54  KAQEFSLPAL-VPTK--LGQEEYE-----QFLSFNADVAVVVAYGLVIPQRILNATKLGF 105
           KA++  +P   +P K  + + E+E     Q  S   D+  +  Y  ++ +  + + K   
Sbjct: 48  KARKEKVPTFPIPYKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKI 107

Query: 106 YNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAG 165
            N H SLLP + G    +R + +G   TG  +  +  ++D GP+     VP+SS    + 
Sbjct: 108 LNIHPSLLPLFPGLHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESS 167

Query: 166 LQQEL 170
           L Q++
Sbjct: 168 LSQKV 172

>gi|254780911|ref|YP_003065324.1| formyltetrahydrofolate deformylase [Candidatus Liberibacter asiaticus str. psy62] Length = 288 Back     alignment
 Score = 32.3 bits (72), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 18/113 (15%)

Query: 50  AVHKK-AQEFSLP--ALVPTKLGQEEYEQFL-----SFNADVAVVVAYGLVIPQRILNAT 101
             HKK  + + LP   L  T+  + E EQ L       N ++ ++  Y  ++   + +  
Sbjct: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180

Query: 102 KLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKH-----LDTGPV 149
                N H S LP ++GA P ++A      E G+ I+    H     LD GP+
Sbjct: 181 TGRIINIHHSFLPSFKGANPYKQAY-----EYGVKIIGATAHYAICELDAGPI 228

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target310 methionyl-tRNA formyltransferase [Candidatus Liberibact
315122857302 methionyl-tRNA formyltransferase [Candidatus Liberibact 1 1e-131
325291801311 methionyl-tRNA formyltransferase [Agrobacterium sp. H13 1 1e-102
15887718311 methionyl-tRNA formyltransferase [Agrobacterium tumefac 1 1e-100
150395283311 methionyl-tRNA formyltransferase [Sinorhizobium medicae 1 1e-99
209547670311 methionyl-tRNA formyltransferase [Rhizobium leguminosar 1 1e-99
241202829311 methionyl-tRNA formyltransferase [Rhizobium leguminosar 1 2e-99
86356071311 methionyl-tRNA formyltransferase [Rhizobium etli CFN 42 1 4e-99
15964173311 methionyl-tRNA formyltransferase [Sinorhizobium melilot 1 7e-99
116250202319 methionyl-tRNA formyltransferase [Rhizobium leguminosar 1 7e-99
190890087311 methionyl-tRNA formyltransferase [Rhizobium etli CIAT 6 1 8e-99
>gi|315122857|ref|YP_004063346.1| methionyl-tRNA formyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 302 Back     alignment and organism information
 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/303 (72%), Positives = 261/303 (86%), Gaps = 1/303 (0%)

Query: 8   MGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPALVPTK 67
           MGTSEFAVATL+AL SSSH+I++VYTQPPRPAGRRGLK+V SAV++ A E ++  L+P K
Sbjct: 1   MGTSEFAVATLRAL-SSSHNILAVYTQPPRPAGRRGLKTVPSAVYQTANELNIQTLIPEK 59

Query: 68  LGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIM 127
           L Q EYEQFL+FNADVAVVV+YGL+IP+RIL+ATKLGFYNGHASLLPRWRGAAPIQRAIM
Sbjct: 60  LRQAEYEQFLNFNADVAVVVSYGLIIPKRILDATKLGFYNGHASLLPRWRGAAPIQRAIM 119

Query: 128 AGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEAMDKLEQ 187
           AGD+ETGIA+MKMD+HLDTGP+  ++++PI  N++   L   LS++CA  +VE MD+LE 
Sbjct: 120 AGDSETGIAVMKMDEHLDTGPIVLVKRIPIPCNMSAGVLHDALSIMCASTIVEVMDRLEN 179

Query: 188 NNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMMIGNKHER 247
           NN+  SPQ+ENGITYA+KI K ET ++F +S+E+VHNHIRALSP PGAWL MMI N+ ER
Sbjct: 180 NNISFSPQVENGITYAQKILKSETHIDFSQSSEDVHNHIRALSPLPGAWLNMMIRNRLER 239

Query: 248 IKLLESQLVEGEGKPGEVINPNFTIACSQGAVRIMRLQRAGGRVLDIGDFLLGCPVIIGC 307
           IKLLESQLVEG G PGE+IN NFTIACSQGA+RIMRLQRAGG  LDI DFLLG P I+GC
Sbjct: 240 IKLLESQLVEGNGHPGEIINSNFTIACSQGAIRIMRLQRAGGHALDIKDFLLGYPAIVGC 299

Query: 308 IVG 310
           IVG
Sbjct: 300 IVG 302


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325291801|ref|YP_004277665.1| methionyl-tRNA formyltransferase [Agrobacterium sp. H13-3] Length = 311 Back     alignment and organism information
>gi|15887718|ref|NP_353399.1| methionyl-tRNA formyltransferase [Agrobacterium tumefaciens str. C58] Length = 311 Back     alignment and organism information
>gi|150395283|ref|YP_001325750.1| methionyl-tRNA formyltransferase [Sinorhizobium medicae WSM419] Length = 311 Back     alignment and organism information
>gi|209547670|ref|YP_002279587.1| methionyl-tRNA formyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 311 Back     alignment and organism information
>gi|241202829|ref|YP_002973925.1| methionyl-tRNA formyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 311 Back     alignment and organism information
>gi|86356071|ref|YP_467963.1| methionyl-tRNA formyltransferase [Rhizobium etli CFN 42] Length = 311 Back     alignment and organism information
>gi|15964173|ref|NP_384526.1| methionyl-tRNA formyltransferase [Sinorhizobium meliloti 1021] Length = 311 Back     alignment and organism information
>gi|116250202|ref|YP_766040.1| methionyl-tRNA formyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 319 Back     alignment and organism information
>gi|190890087|ref|YP_001976629.1| methionyl-tRNA formyltransferase [Rhizobium etli CIAT 652] Length = 311 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target310 methionyl-tRNA formyltransferase [Candidatus Liberibact
PRK00005309 PRK00005, fmt, methionyl-tRNA formyltransferase; Review 1e-106
TIGR00460313 TIGR00460, fmt, methionyl-tRNA formyltransferase 2e-61
PLN02285334 PLN02285, PLN02285, methionyl-tRNA formyltransferase 2e-40
PRK08125 660 PRK08125, PRK08125, bifunctional UDP-glucuronic acid de 1e-27
PRK06988312 PRK06988, PRK06988, putative formyltransferase; Provisi 9e-18
COG0223307 COG0223, Fmt, Methionyl-tRNA formyltransferase [Transla 6e-89
KOG3082338 KOG3082, KOG3082, KOG3082, Methionyl-tRNA formyltransfe 4e-28
KOG2452 881 KOG2452, KOG2452, KOG2452, Formyltetrahydrofolate dehyd 1e-21
pfam00551181 pfam00551, Formyl_trans_N, Formyl transferase 2e-27
TIGR00639190 TIGR00639, PurN, phosphoribosylglycinamide formyltransf 3e-07
pfam0291199 pfam02911, Formyl_trans_C, Formyl transferase, C-termin 2e-21
COG0299200 COG0299, PurN, Folate-dependent phosphoribosylglycinami 3e-10
KOG3076206 KOG3076, KOG3076, KOG3076, 5'-phosphoribosylglycinamide 8e-08
PRK05647200 PRK05647, purN, phosphoribosylglycinamide formyltransfe 5e-07
>gnl|CDD|178787 PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|161888 TIGR00460, fmt, methionyl-tRNA formyltransferase Back     alignment and domain information
>gnl|CDD|177923 PLN02285, PLN02285, methionyl-tRNA formyltransferase Back     alignment and domain information
>gnl|CDD|181239 PRK08125, PRK08125, bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>gnl|CDD|180785 PRK06988, PRK06988, putative formyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30572 COG0223, Fmt, Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|38292 KOG3082, KOG3082, KOG3082, Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|37663 KOG2452, KOG2452, KOG2452, Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|144222 pfam00551, Formyl_trans_N, Formyl transferase Back     alignment and domain information
>gnl|CDD|161973 TIGR00639, PurN, phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent Back     alignment and domain information
>gnl|CDD|145851 pfam02911, Formyl_trans_C, Formyl transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|30647 COG0299, PurN, Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|38286 KOG3076, KOG3076, KOG3076, 5'-phosphoribosylglycinamide formyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|180182 PRK05647, purN, phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 310 methionyl-tRNA formyltransferase [Candidatus Liberibact
PRK00005309 fmt methionyl-tRNA formyltransferase; Reviewed 100.0
COG0223307 Fmt Methionyl-tRNA formyltransferase [Translation, ribo 100.0
PRK06988313 putative formyltransferase; Provisional 100.0
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 100.0
TIGR00460385 fmt methionyl-tRNA formyltransferase; InterPro: IPR0057 100.0
KOG2452 881 consensus 100.0
KOG3082338 consensus 100.0
pfam00551181 Formyl_trans_N Formyl transferase. This family includes 100.0
PRK05647200 purN phosphoribosylglycinamide formyltransferase; Revie 100.0
TIGR00639215 PurN phosphoribosylglycinamide formyltransferase; Inter 99.97
COG0299200 PurN Folate-dependent phosphoribosylglycinamide formylt 99.96
PRK06027285 purU formyltetrahydrofolate deformylase; Reviewed 99.93
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 99.92
PRK13011287 formyltetrahydrofolate deformylase; Reviewed 99.92
KOG3076206 consensus 99.9
TIGR00655294 PurU formyltetrahydrofolate deformylase; InterPro: IPR0 99.83
COG0788287 PurU Formyltetrahydrofolate hydrolase [Nucleotide trans 99.8
PRK07579245 hypothetical protein; Provisional 100.0
pfam0291199 Formyl_trans_C Formyl transferase, C-terminal domain. 99.89
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 95.75
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 94.18
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 94.1
PRK06395 435 phosphoribosylamine--glycine ligase; Provisional 93.47
pfam00185155 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Or 92.74
KOG2741351 consensus 91.95
TIGR03590280 PseG pseudaminic acid biosynthesis-associated protein P 91.09
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating). 90.75
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 90.75
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 90.64
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 90.22
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 94.6
COG3804350 Uncharacterized conserved protein related to dihydrodip 93.07
pfam00148398 Oxidored_nitro Nitrogenase component 1 type Oxidoreduct 91.69
cd03466429 Nitrogenase_NifN_2 Nitrogenase_nifN_2: A subgroup of th 94.53
PRK09496 455 trkA potassium transporter peripheral membrane componen 94.16
PRK00048265 dihydrodipicolinate reductase; Provisional 93.69
PRK08229341 2-dehydropantoate 2-reductase; Provisional 93.5
CHL00194319 ycf39 Ycf39; Provisional 90.9
KOG1502327 consensus 93.23
>PRK00005 fmt methionyl-tRNA formyltransferase; Reviewed Back     alignment and domain information
>COG0223 Fmt Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06988 putative formyltransferase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR00460 fmt methionyl-tRNA formyltransferase; InterPro: IPR005794 Methionyl-tRNA formyltransferase (2 Back     alignment and domain information
>KOG2452 consensus Back     alignment and domain information
>KOG3082 consensus Back     alignment and domain information
>pfam00551 Formyl_trans_N Formyl transferase Back     alignment and domain information
>PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information
>TIGR00639 PurN phosphoribosylglycinamide formyltransferase; InterPro: IPR004607 This family describes phosphoribosylglycinamide formyltransferase (GAR transformylase), one of several proteins found in formyltransferase Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>KOG3076 consensus Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase; InterPro: IPR004810 An Escherichia coli gene designated purU has been identified and characterised Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07579 hypothetical protein; Provisional Back     alignment and domain information
>pfam02911 Formyl_trans_C Formyl transferase, C-terminal domain Back     alignment and domain information
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>pfam00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain Back     alignment and domain information
>KOG2741 consensus Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>pfam03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>pfam00148 Oxidored_nitro Nitrogenase component 1 type Oxidoreductase Back     alignment and domain information
>cd03466 Nitrogenase_NifN_2 Nitrogenase_nifN_2: A subgroup of the NifN subunit of the NifEN complex: NifN forms an alpha2beta2 tetramer with NifE Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>KOG1502 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target310 methionyl-tRNA formyltransferase [Candidatus Liberibact
1fmt_A314 Methionyl-Trnafmet Formyltransferase From Escherich 3e-49
3r8x_A318 Crystal Structure Of Methionyl-Trna Formyltransfera 2e-46
3rfo_A317 Crystal Structure Of Methyionyl-Trna Formyltransfer 1e-41
3q0i_A318 Methionyl-Trna Formyltransferase From Vibrio Choler 1e-40
2bln_A305 N-Terminal Formyltransferase Domain Of Arna In Comp 1e-22
1z7e_A 660 Crystal Structure Of Full Length Arna Length = 660 1e-22
1yrw_A302 Crystal Structure Of E.Coli Arna Transformylase Dom 9e-22
1s3i_A310 Crystal Structure Of The N Terminal Hydrolase Domai 1e-19
2bw0_A329 Crystal Structure Of The Hydrolase Domain Of Human 7e-18
>gi|2914332|pdb|1FMT|A Chain A, Methionyl-Trnafmet Formyltransferase From Escherichia Coli Length = 314 Back     alignment and structure
 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 117/316 (37%), Positives = 179/316 (56%), Gaps = 13/316 (4%)

Query: 2   TLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLP 61
           +LR++F GT +FA   L AL+SS H++V V+TQP RPAG RG K + S V   A+E  LP
Sbjct: 3   SLRIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAG-RGKKLMPSPVKVLAEEKGLP 61

Query: 62  ALVPTKLGQEEYEQFLSFNA-DVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAA 120
              P  L  +E +Q ++    DV VVVAYGL++P+ +L   +LG  N H SLLPRWRGAA
Sbjct: 62  VFQPVSLRPQENQQLVAELQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAA 121

Query: 121 PIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVE 180
           PIQR++ AGD ETG+ IM+MD  LDTG + +    PI++   +  L  +L+ L    ++ 
Sbjct: 122 PIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLIT 181

Query: 181 AMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMM 240
            + +L         Q E  +TYAEK+SK E R+++  SA  +   IRA +P+P +WLE+ 
Sbjct: 182 TLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIE 241

Query: 241 IGNKHERIKLLESQLVE--GEGKPGEVI---NPNFTIACSQGAVRIMRLQRAGGRVLDIG 295
                + +K+ ++ +++      PG ++        +A   G + ++ LQ AG + +   
Sbjct: 242 G----QPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQ 297

Query: 296 DFLLGCP--VIIGCIV 309
           D L       + G  +
Sbjct: 298 DLLNSRREWFVPGNRL 313


>gi|328877395|pdb|3R8X|A Chain A, Crystal Structure Of Methionyl-Trna Formyltransferase From Yersinia Pestis Complexed With L-Methionine Length = 318 Back     alignment and structure
>gi|329666301|pdb|3RFO|A Chain A, Crystal Structure Of Methyionyl-Trna Formyltransferase From Bacillus Anthracis Length = 317 Back     alignment and structure
>gi|315583678|pdb|3Q0I|A Chain A, Methionyl-Trna Formyltransferase From Vibrio Cholerae Length = 318 Back     alignment and structure
>gi|66361563|pdb|2BLN|A Chain A, N-Terminal Formyltransferase Domain Of Arna In Complex With N-5-Formyltetrahydrofolate And Ump Length = 305 Back     alignment and structure
gi|71042200|pdb|1Z7E|A Chain A, Crystal Structure Of Full Length Arna Length = 660 Back     alignment and structure
>gi|66361188|pdb|1YRW|A Chain A, Crystal Structure Of E.Coli Arna Transformylase Domain Length = 302 Back     alignment and structure
>gi|42543697|pdb|1S3I|A Chain A, Crystal Structure Of The N Terminal Hydrolase Domain Of 10- Formyltetrahydrofolate Dehydrogenase Length = 310 Back     alignment and structure
>gi|73536304|pdb|2BW0|A Chain A, Crystal Structure Of The Hydrolase Domain Of Human 10- Formyltetrahydrofolate 2 Dehydrogenase Length = 329 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target310 methionyl-tRNA formyltransferase [Candidatus Liberibact
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrolase; H 1e-88
1fmt_A314 Methionyl-tRNA FMet formyltransferase; initiator tRNA, 2e-79
2bw0_A329 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nuc 3e-38
2bln_A305 Protein YFBG; transferase, formyltransferase, L-ARA4N b 4e-34
1jkx_A212 GART;, phosphoribosylglycinamide formyltransferase; pur 1e-22
1meo_A209 Phosophoribosylglycinamide formyltransferase; purine bi 2e-22
3kcq_A215 Phosphoribosylglycinamide formyltransferase; structural 6e-21
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT doma 2e-17
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transferase, 9e-16
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossmann f 1e-13
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransferase 2e-13
1zgh_A260 Methionyl-tRNA formyltransferase; southeast collaborato 4e-21
3lou_A292 Formyltetrahydrofolate deformylase; structural genomics 1e-20
3obi_A288 Formyltetrahydrofolate deformylase; structural genomics 6e-19
3o1l_A302 Formyltetrahydrofolate deformylase; structural genomics 6e-19
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 Back     alignment and structure
 Score =  321 bits (825), Expect = 1e-88
 Identities = 70/312 (22%), Positives = 141/312 (45%), Gaps = 13/312 (4%)

Query: 3   LRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPA 62
           ++ V     +     ++AL+++ + I +++T    P    G K+   +V + A E  +P 
Sbjct: 1   MKTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDNP----GEKAFYGSVARLAAERGIPV 56

Query: 63  LVPTKL-GQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAP 121
             P  +      E+    + DV     Y  +I   IL     G +N H SLLP++RG AP
Sbjct: 57  YAPDNVNHPLWVERIAQLSPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAP 116

Query: 122 IQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEA 181
           +   ++ G+ ETG+ + +M K  D G +    ++ I+ +     L  +L       + + 
Sbjct: 117 LNWVLVNGETETGVTLHRMVKRADAGAIVAQLRIAIAPDDIAITLHHKLCHAARQLLEQT 176

Query: 182 MDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALS-PFPGAWLEMM 240
           +  ++  N+    Q EN  T   + +  ++ + + + A  +HN +RA++ P+PGA+  + 
Sbjct: 177 LPAIKHGNILEIAQRENEATCFGRRTPDDSFLEWHKPASVLHNMVRAVADPWPGAFSYV- 235

Query: 241 IGNKHERIKLLESQLVE--GEGKPGEVINPN-FTIACSQGAVRIMRLQRAGGRVLDIGDF 297
               +++  +  S++     + +PG VI+     IAC  GA+ I+  Q   G  +     
Sbjct: 236 ---GNQKFTVWSSRVHPHASKAQPGSVISVAPLLIACGDGALEIVTGQAGDGITMQGSQL 292

Query: 298 LLGCPVIIGCIV 309
                ++ G  +
Sbjct: 293 AQTLGLVQGSRL 304


>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* Length = 314 Back     alignment and structure
>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A Length = 329 Back     alignment and structure
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A Length = 305 Back     alignment and structure
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Length = 212 Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Length = 209 Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ} Length = 215 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Length = 287 Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Length = 286 Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Length = 216 Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Length = 215 Back     alignment and structure
>1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory for structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum atcc 27405} SCOP: b.46.1.1 c.65.1.1 Length = 260 Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia mallei} Length = 292 Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.95A {Rhodopseudomonas palustris} Length = 288 Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 2.20A {Pseudomonas syringae PV} Length = 302 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target310 methionyl-tRNA formyltransferase [Candidatus Liberibact
1fmt_A314 Methionyl-tRNA FMet formyltransferase; initiator tRNA, 100.0
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrolase; H 100.0
2bw0_A329 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nuc 100.0
2bln_A305 Protein YFBG; transferase, formyltransferase, L-ARA4N b 100.0
1zgh_A260 Methionyl-tRNA formyltransferase; southeast collaborato 100.0
1jkx_A212 GART;, phosphoribosylglycinamide formyltransferase; pur 100.0
3kcq_A215 Phosphoribosylglycinamide formyltransferase; structural 100.0
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransferase 100.0
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossmann f 100.0
1meo_A209 Phosophoribosylglycinamide formyltransferase; purine bi 100.0
3o1l_A302 Formyltetrahydrofolate deformylase; structural genomics 100.0
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT doma 100.0
3lou_A292 Formyltetrahydrofolate deformylase; structural genomics 100.0
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transferase, 100.0
3obi_A288 Formyltetrahydrofolate deformylase; structural genomics 100.0
3euw_A344 MYO-inositol dehydrogenase; protein structure initiativ 97.21
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO- 97.04
3ec7_A357 Putative dehydrogenase; alpha-beta, structural genomics 96.86
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, MCSG 96.85
3ezy_A344 Dehydrogenase; structural genomics, unknown function, P 96.69
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel, rin 96.47
1lss_A140 TRK system potassium uptake protein TRKA homolog; KTN d 96.19
3gpi_A286 NAD-dependent epimerase/dehydratase; structural genomic 96.02
2o4u_X334 Dimeric dihydrodiol dehydrogenase; NADP-binding rossman 95.81
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 95.8
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI-2, p 95.58
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 95.55
1tlt_A319 Putative oxidoreductase (virulence factor MVIM homolog) 95.5
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 95.49
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; structura 95.41
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-chain de 95.4
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreducta 95.2
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; HET: N 94.96
1ydw_A362 AX110P-like protein; structural genomics, protein struc 94.95
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, structural 94.84
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI- 94.82
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro linke 94.79
3ic5_A118 Putative saccharopine dehydrogenase; structural genomic 94.76
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; reductive methylat 94.63
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, HAEM d 94.62
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural genomi 94.39
3db2_A354 Putative NADPH-dependent oxidoreductase; ZP_01370612.1, 94.09
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, short 94.0
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics consor 93.96
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, short-c 93.27
1zh8_A340 Oxidoreductase; TM0312, structural genomics, joint cent 93.22
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-cha 93.12
2g1u_A155 Hypothetical protein TM1088A; structural genomics, join 92.94
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogenase/re 92.57
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding, ros 92.44
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65 92.19
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, structural 92.17
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogenase, g 92.07
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, l 92.04
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2, NYS 91.22
1yqg_A263 Pyrroline-5-carboxylate reductase; structural genomics, 91.11
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/ 90.81
2rcy_A262 Pyrroline carboxylate reductase; malaria, structural ge 90.81
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, shor 90.5
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural genomics, 90.04
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, structural 95.64
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, 94.32
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, iso 93.87
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, PSI- 93.84
3ius_A286 Uncharacterized conserved protein; APC63810, silicibact 93.46
3kux_A352 Putative oxidoreductase; oxidoreductase family, csgid, 93.21
1vpd_A299 Tartronate semialdehyde reductase; structural genomics, 92.95
2ahr_A259 Putative pyrroline carboxylate reductase; pyrroline red 92.68
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural geno 92.59
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhi 92.31
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CI 92.19
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent e 91.78
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogen 91.65
1qgu_B519 Protein (nitrogenase molybdenum iron protein); biologic 91.5
3i83_A320 2-dehydropantoate 2-reductase; structural genomics, oxi 90.94
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural genomics 90.84
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, bio 90.28
3d1l_A266 Putative NADP oxidoreductase BF3122; structural genomic 94.0
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, N 92.56
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, stru 91.95
>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=590.78  Aligned_cols=303  Identities=39%  Similarity=0.673  Sum_probs=289.1

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCCH-HHHHHCC
Q ss_conf             706999779868899999999679849999827578227578756789889999985997997024344200-2342104
Q gi|255764462|r    2 TLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPALVPTKLGQEEY-EQFLSFN   80 (310)
Q Consensus         2 ~mkI~f~G~~~~~~~~l~~l~~~~~~i~~vvt~~d~~~~~~~~~~~~~~v~~~a~~~~ip~~~~~~~~~~~~-~~l~~~~   80 (310)
                      +|||+||||++||+++|++|++++++|++|||+||++.| |+.+...++++++|+++|||+++++++++++. +.+++++
T Consensus         3 ~mkI~f~Gs~~~a~~~L~~L~~~~~~i~~VvT~pd~~~g-rg~~~~~~~v~~~A~~~~i~~~~~~~~~~~~~~~~~~~~~   81 (314)
T 1fmt_A            3 SLRIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAG-RGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVAELQ   81 (314)
T ss_dssp             CCEEEEEECSHHHHHHHHHHHHTTCEEEEEECCCCBC-------CBCCHHHHHHHHTTCCEECCSCSCSHHHHHHHHHTT
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCC-CCCCCCCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCC
T ss_conf             628999889889999999999789977999909998556-8884889979999998599840352346288999998519


Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHCCCCCCCC
Q ss_conf             57313202421124430012110010102322210332002444431034545432022012332034542014543332
Q gi|255764462|r   81 ADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSN  160 (310)
Q Consensus        81 ~D~~v~~~~~~ii~~~il~~~~~g~iN~H~s~LP~yRG~~pi~wai~~g~~~~g~t~~~~~~~~D~G~Ii~q~~~~I~~~  160 (310)
                      +|++++++|+++||+++|+.|++|+||+|||+||+|||++|++|||+|||+++|+|+|+|++++|+|||++|++++|.++
T Consensus        82 ~dl~i~~~~~~iip~~~l~~~~~g~iN~H~slLP~yRG~~pi~wail~g~~~~Gvti~~~~~~~D~G~Ii~q~~~~i~~~  161 (314)
T 1fmt_A           82 ADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAE  161 (314)
T ss_dssp             CSEEEEESCCSCCCHHHHHSSTTCEEEEESSSTTTTBSSCHHHHHHHHTCSEEEEEEEECCSSSSCSCEEEEEEEECCTT
T ss_pred             CCEEEEEECCCCCCHHHHHCCCCCEEECCCCCCCCCCCCCHHHHHHHCCCCCCCEEEEEECCCCCCCCCEEEEEEECCCC
T ss_conf             99999971264699999857897778255554777667588999997799753159999626756777147899630456


Q ss_pred             CCHHHHHHCCCCCCHHHHHHHCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEE
Q ss_conf             21011000002330112232000000024655678830001112221122221024568888875431276654248994
Q gi|255764462|r  161 INTAGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEKISKGETRVNFCRSAENVHNHIRALSPFPGAWLEMM  240 (310)
Q Consensus       161 ~t~~~L~~kl~~~~~~ll~~~l~~i~~g~~~~~~Q~~~~~sy~~k~~~~d~~Idw~~~a~~I~n~iRA~~P~PgA~~~~~  240 (310)
                      +|+.+|+++++..+..++.+++..+.+++.++++|+++.+|||||++++|++|||+++|++|+|+||||+||||||+.+ 
T Consensus       162 ~t~~~L~~k~~~~~~~ll~~~l~~l~~~~~~~~~Q~~~~aty~~ki~~~d~~Idw~~~a~~I~~~iRA~~p~pga~~~~-  240 (314)
T 1fmt_A          162 DTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEI-  240 (314)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCBCCCGGGCCBCCCCCHHHHBCCTTSBHHHHHHHHHHTTTTTCEEEEE-
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCEECCCCCHHHHEECHHHHHHHHHHHHCCCCCCCCCCEEC-
T ss_conf             5389999998764215668899998669964173898776367878888900158679999977321658999722104-


Q ss_pred             ECCCCEEEEEEEEEECCC--CCCCCEEE---ECCEEEEECCCEEEEEEEECCCCCCCCHHHHHCCCC--CCCCCCC
Q ss_conf             058514667886565178--88873797---488799807986999988548697124889964799--9988407
Q gi|255764462|r  241 IGNKHERIKLLESQLVEG--EGKPGEVI---NPNFTIACSQGAVRIMRLQRAGGRVLDIGDFLLGCP--VIIGCIV  309 (310)
Q Consensus       241 ~~~~~~~iki~~~~~~~~--~~~pG~I~---~~~l~V~c~dG~i~I~~lq~~Gkk~m~a~df~ng~~--~~~G~~l  309 (310)
                         +++++++++++..+.  .++||+|+   +++++|+|+||+|+|.+||+||||+|+|.||+||++  +.+|++|
T Consensus       241 ---~g~~ikI~~~~~~~~~~~~~PG~i~~~~~~~l~V~c~dG~l~I~~lq~eGKk~m~a~df~ng~r~~~~~G~~l  313 (314)
T 1fmt_A          241 ---EGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRREWFVPGNRL  313 (314)
T ss_dssp             ---TTEEEEEEEEEEECCCCCSCTTBEEEEETTEEEEECSBSEEEEEEEEETTSCCEEHHHHHHHSGGGSCTTCBC
T ss_pred             ---CCCEEEEEEEEEECCCCCCCCCEEEEECCCEEEEEECCEEEEECEEECCCCCEEEHHHHHCCCCCCCCCCCEE
T ss_conf             ---8966999999993477899996899977983999979839997889999999822999962897658997993



>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A Back     alignment and structure
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A Back     alignment and structure
>1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory for structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum atcc 27405} SCOP: b.46.1.1 c.65.1.1 Back     alignment and structure
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium LT2} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural genomics, PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2o4u_X Dimeric dihydrodiol dehydrogenase; NADP-binding rossmann-fold domain, predominantly anti- parallel beta sheet, oxidoreductase; 2.00A {Macaca fascicularis} PDB: 2o48_X 2poq_X* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM homolog); structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, PSI-2, protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomerase; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase family, NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genomics, protein structure initiative, PSI; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, PSI-2, protein structure initiative; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2ho3_A Oxidoreductase, GFO/IDH/MOCA family; reductive methylation, structural genomics, PSI 2, protein structure initiative; HET: MLY; 2.00A {Streptococcus pneumoniae} PDB: 2ho5_A Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; ZP_01370612.1, structural genomics, joint center for structural genomics, JCSG; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MSE NAP; 2.50A {Thermotoga maritima MSB8} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genomics, NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus VF5} PDB: 2z95_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, JCSG, protein structure initiative, PSI; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 1.90A {Neisseria meningitidis MC58} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoreductase, structural genomics consortium; HET: NAP; 2.30A {Plasmodium falciparum 3D7} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, lyase; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genomics, joint center for structural genomics, JCSG; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center for structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P)binding protein, rossmann fold; HET: NAP; 2.15A {Streptococcus pyogenes m1 gas} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1qgu_B Protein (nitrogenase molybdenum iron protein); biological nitrogen fixation, nitrogen metabolism, molybdoenzymes, electron transfer; HET: HCA CFM CLF; 1.60A {Klebsiella pneumoniae} SCOP: c.92.2.3 PDB: 1h1l_B* 1qh1_B* 1qh8_B* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate biosynthesis, PSI-2; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative; 2.19A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.00A {Pyrococcus horikoshii OT3} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 310 methionyl-tRNA formyltransferase [Candidatus Liberibact
d1fmta2206 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase 3e-32
d2bw0a2203 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogen 5e-25
d2blna2203 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N 1e-24
d1jkxa_209 c.65.1.1 (A:) Glycinamide ribonucleotide transformylase 9e-11
d1zgha2164 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase 5e-16
d2bw0a1104 b.46.1.1 (A:204-307) 10-formyltetrahydrofolate dehydrog 1e-15
d1fmta1108 b.46.1.1 (A:207-314) Methionyl-tRNAfmet formyltransfera 1e-14
d2blna1101 b.46.1.1 (A:204-304) Polymyxin resistance protein ArnA, 4e-12
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Formyltransferase
superfamily: Formyltransferase
family: Formyltransferase
domain: Methionyl-tRNAfmet formyltransferase
species: Escherichia coli [TaxId: 562]
 Score =  132 bits (332), Expect = 3e-32
 Identities = 82/203 (40%), Positives = 114/203 (56%)

Query: 3   LRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPA 62
           LR++F GT +FA   L AL+SS H++V V+TQP RPAGR              ++     
Sbjct: 4   LRIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVF 63

Query: 63  LVPTKLGQEEYEQFLSFNADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPI 122
              +   QE  +      ADV VVVAYGL++P+ +L   +LG  N H SLLPRWRGAAPI
Sbjct: 64  QPVSLRPQENQQLVAELQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPI 123

Query: 123 QRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSNINTAGLQQELSVLCAHAMVEAM 182
           QR++ AGD ETG+ IM+MD  LDTG + +    PI++   +  L  +L+ L    ++  +
Sbjct: 124 QRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTL 183

Query: 183 DKLEQNNLPLSPQIENGITYAEK 205
            +L         Q E  +TYAEK
Sbjct: 184 KQLADGTAKPEVQDETLVTYAEK 206


>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 203 Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 203 Back     information, alignment and structure
>d1jkxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]} Length = 209 Back     information, alignment and structure
>d1zgha2 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]} Length = 164 Back     information, alignment and structure
>d2bw0a1 b.46.1.1 (A:204-307) 10-formyltetrahydrofolate dehydrogenase domain 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fmta1 b.46.1.1 (A:207-314) Methionyl-tRNAfmet formyltransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d2blna1 b.46.1.1 (A:204-304) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]} Length = 101 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target310 methionyl-tRNA formyltransferase [Candidatus Liberibact
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia coli 100.0
d2blna2203 Polymyxin resistance protein ArnA, N-terminal domain {E 100.0
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 {Human 100.0
d1jkxa_209 Glycinamide ribonucleotide transformylase, GART {Escher 100.0
d1meoa_205 Glycinamide ribonucleotide transformylase, GART {Human 100.0
d1zgha2164 Methionyl-tRNAfmet formyltransferase {Clostridium therm 99.97
d1fmta1108 Methionyl-tRNAfmet formyltransferase, C-terminal domain 99.93
d2blna1101 Polymyxin resistance protein ArnA, domain 2 {Escherichi 99.91
d2bw0a1104 10-formyltetrahydrofolate dehydrogenase domain 2 {Human 99.88
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2 96.38
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Arabido 95.66
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) [Tax 95.37
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galactose 4 95.31
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 562]} 94.58
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId 93.47
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis 93.44
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. 93.37
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [TaxId 93.24
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archa 92.93
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococcus p 92.6
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria menin 92.15
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain {Zym 91.68
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galactose 4 91.61
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 9037 90.28
d1zgha162 Methionyl-tRNAfmet formyltransferase, C-terminal domain 96.27
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacter 92.56
d1qh8b_519 Nitrogenase iron-molybdenum protein, beta chain {Klebsi 91.96
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Formyltransferase
superfamily: Formyltransferase
family: Formyltransferase
domain: Methionyl-tRNAfmet formyltransferase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=360.73  Aligned_cols=203  Identities=45%  Similarity=0.722  Sum_probs=192.5

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCCCCC-HHHHHHCC
Q ss_conf             70699977986889999999967984999982757822757875678988999998599799702434420-02342104
Q gi|255764462|r    2 TLRVVFMGTSEFAVATLQALVSSSHSIVSVYTQPPRPAGRRGLKSVLSAVHKKAQEFSLPALVPTKLGQEE-YEQFLSFN   80 (310)
Q Consensus         2 ~mkI~f~G~~~~~~~~l~~l~~~~~~i~~vvt~~d~~~~~~~~~~~~~~v~~~a~~~~ip~~~~~~~~~~~-~~~l~~~~   80 (310)
                      ||||+|+|+++||..+|++|++++++|++|+|.||++.+ ++.......+..+|.++++|++..+..+++. .+.+++.+
T Consensus         3 ~mKI~f~G~~~~~~~~L~~L~~~~~~i~~Vit~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (206)
T d1fmta2           3 SLRIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAG-RGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVAELQ   81 (206)
T ss_dssp             CCEEEEEECSHHHHHHHHHHHHTTCEEEEEECCCCBC-------CBCCHHHHHHHHTTCCEECCSCSCSHHHHHHHHHTT
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCC-CCCCCCCCCHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHC
T ss_conf             748999889889999999999689977999969983013-6762233623210100376532222222114677776413


Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHCCCCCCCC
Q ss_conf             57313202421124430012110010102322210332002444431034545432022012332034542014543332
Q gi|255764462|r   81 ADVAVVVAYGLVIPQRILNATKLGFYNGHASLLPRWRGAAPIQRAIMAGDNETGIAIMKMDKHLDTGPVAFMRKVPISSN  160 (310)
Q Consensus        81 ~D~~v~~~~~~ii~~~il~~~~~g~iN~H~s~LP~yRG~~pi~wai~~g~~~~g~t~~~~~~~~D~G~Ii~q~~~~I~~~  160 (310)
                      +|++++++|+++||+++|+.|++|+||+|||+||+|||++|++|||+||++++|+|+|+|++++|+|||++|++++|.++
T Consensus        82 ~d~~v~~~~~~ii~~~il~~~k~g~iN~Hps~LP~yRG~~pi~wai~nge~~~GvT~h~i~~~iD~G~Ii~q~~~~i~~~  161 (206)
T d1fmta2          82 ADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAE  161 (206)
T ss_dssp             CSEEEEESCCSCCCHHHHHSSTTCEEEEESSSTTTTBSSCHHHHHHHHTCSEEEEEEEECCSSSSCSCEEEEEEEECCTT
T ss_pred             CEEEEEECCCCCCCHHHHHCCCCCEEECCCHHHHHHHHHHHHHHHHHCCCCEECEEEEEECCCCCHHHHHHHHCCCCCCC
T ss_conf             32788641221366546753877745258235676520001325887498235306888615557577643001344335


Q ss_pred             CCHHHHHHCCCCCCHHHHHHHCCHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             210110000023301122320000000246556788300011122
Q gi|255764462|r  161 INTAGLQQELSVLCAHAMVEAMDKLEQNNLPLSPQIENGITYAEK  205 (310)
Q Consensus       161 ~t~~~L~~kl~~~~~~ll~~~l~~i~~g~~~~~~Q~~~~~sy~~k  205 (310)
                      ||+.+|++++..++.+++.++++.+.+|++++++|+++.+|||+|
T Consensus       162 dt~~~l~~k~~~~~~~l~~~~i~~i~~~~~~~~~Q~~~~atY~~K  206 (206)
T d1fmta2         162 DTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEK  206 (206)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCBCCCGGGCCBCCC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCCCC
T ss_conf             659999999999999999999999984998426599987878999



>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jkxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgha2 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1fmta1 b.46.1.1 (A:207-314) Methionyl-tRNAfmet formyltransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2blna1 b.46.1.1 (A:204-304) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bw0a1 b.46.1.1 (A:204-307) 10-formyltetrahydrofolate dehydrogenase domain 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure