255764466

255764466

hypothetical protein CLIBASIA_01255

GeneID in NCBI database:8209351Locus tag:CLIBASIA_01255
Protein GI in NCBI database:255764466Protein Accession:YP_003064779.2
Gene range:+(264256, 264780)Protein Length:174aa
Gene description:hypothetical protein
COG prediction:[O] Disulfide bond formation protein DsbB
KEGG prediction:hypothetical protein
SEED prediction:Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Biogenesis of c-type cytochromes;
Periplasmic disulfide interchange
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED3 TM-Helix
HMMTOP4 TM-Helix
MEMSAT4 TM-Helix
MEMSAT_SVM4 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK
cHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHccccc
ccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEcccccccccccccccccccccHHHHHHHHcccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccc
MIKSLLSTlaniplpriILLNISGVIVCFLMIqhvggyppcdlciqeqkIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIEcgiweknaicmnnskieSITSTVDLLTQMEqenipscnkttLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK
MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK
MIKSLLSTlaniplpriillniSGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRlllmtlgllmFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK
********LANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISR**
MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK
*IKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKIS***
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiii
SSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK
MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK
MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target174 hypothetical protein CLIBASIA_01255 [Candidatus Liberib
315122174180 hypothetical protein CKC_02120 [Candidatus Liberibacter 1 1e-45
222087335170 hypothetical protein Arad_4180 [Agrobacterium radiobact 1 2e-21
307313026169 conserved hypothetical protein [Sinorhizobium meliloti 1 7e-21
15966387169 hypothetical protein SMc00738 [Sinorhizobium meliloti 1 1 7e-21
227823211207 hypothetical protein NGR_c26810 [Sinorhizobium fredii N 1 1e-20
163759901169 hypothetical protein HPDFL43_16761 [Hoeflea phototrophi 1 1e-18
332716324171 disulfide bond formation protein B [Agrobacterium sp. H 1 2e-18
15891403171 hypothetical protein Atu3538 [Agrobacterium tumefaciens 1 2e-18
209551128171 hypothetical protein Rleg2_3552 [Rhizobium leguminosaru 1 3e-18
190893619171 hypothetical protein RHECIAT_CH0004053 [Rhizobium etli 1 9e-18
>gi|315122174|ref|YP_004062663.1| hypothetical protein CKC_02120 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 180 Back     alignment and organism information
 Score =  186 bits (471), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 130/171 (76%)

Query: 1   MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALV 60
           MIKSLLS L NI + RII   I+G+I+ FL IQHVGGY PCD C++EQ+ YY+ FL+A+ 
Sbjct: 1   MIKSLLSKLENIYIIRIITTIIAGIIISFLTIQHVGGYAPCDFCLREQRPYYYCFLMAIA 60

Query: 61  ADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITS 120
           A+ S +N+  Y +T  LLMT+ L+M ++  IS+IHVGIE  IW +N IC N+SKIES+ +
Sbjct: 61  ANFSIQNNRLYRTTFFLLMTISLVMLYDTIISIIHVGIEWNIWRENTICTNDSKIESVKN 120

Query: 121 TVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKIS 171
           T+DLLT ME+E+I  CN+T LY+LGLSLAFWN+I+SF LS ++ IA  K S
Sbjct: 121 TIDLLTHMEREHILRCNQTKLYILGLSLAFWNVILSFMLSVLSYIAAGKTS 171


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222087335|ref|YP_002545872.1| hypothetical protein Arad_4180 [Agrobacterium radiobacter K84] Length = 170 Back     alignment and organism information
>gi|307313026|ref|ZP_07592653.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C] Length = 169 Back     alignment and organism information
>gi|15966387|ref|NP_386740.1| hypothetical protein SMc00738 [Sinorhizobium meliloti 1021] Length = 169 Back     alignment and organism information
>gi|227823211|ref|YP_002827183.1| hypothetical protein NGR_c26810 [Sinorhizobium fredii NGR234] Length = 207 Back     alignment and organism information
>gi|163759901|ref|ZP_02166985.1| hypothetical protein HPDFL43_16761 [Hoeflea phototrophica DFL-43] Length = 169 Back     alignment and organism information
>gi|332716324|ref|YP_004443790.1| disulfide bond formation protein B [Agrobacterium sp. H13-3] Length = 171 Back     alignment and organism information
>gi|15891403|ref|NP_357075.1| hypothetical protein Atu3538 [Agrobacterium tumefaciens str. C58] Length = 171 Back     alignment and organism information
>gi|209551128|ref|YP_002283045.1| hypothetical protein Rleg2_3552 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 171 Back     alignment and organism information
>gi|190893619|ref|YP_001980161.1| hypothetical protein RHECIAT_CH0004053 [Rhizobium etli CIAT 652] Length = 171 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target174 hypothetical protein CLIBASIA_01255 [Candidatus Liberib
COG1495170 COG1495, DsbB, Disulfide bond formation protein DsbB [P 6e-07
PRK02110169 PRK02110, PRK02110, disulfide bond formation protein B; 0.002
pfam02600159 pfam02600, DsbB, Disulfide bond formation protein DsbB 1e-13
>gnl|CDD|31684 COG1495, DsbB, Disulfide bond formation protein DsbB [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179370 PRK02110, PRK02110, disulfide bond formation protein B; Provisional Back     alignment and domain information
>gnl|CDD|145639 pfam02600, DsbB, Disulfide bond formation protein DsbB Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 174 hypothetical protein CLIBASIA_01255 [Candidatus Liberib
PRK04388172 disulfide bond formation protein B; Provisional 100.0
pfam02600159 DsbB Disulfide bond formation protein DsbB. This family 100.0
PRK02110169 disulfide bond formation protein B; Provisional 100.0
PRK01749175 disulfide bond formation protein B; Provisional 100.0
COG1495170 DsbB Disulfide bond formation protein DsbB [Posttransla 99.97
PRK04307220 putative disulfide oxidoreductase; Provisional 99.75
PRK03113139 putative disulfide oxidoreductase; Provisional 99.68
PRK00611135 putative disulfide oxidoreductase; Provisional 99.62
>PRK04388 disulfide bond formation protein B; Provisional Back     alignment and domain information
>pfam02600 DsbB Disulfide bond formation protein DsbB Back     alignment and domain information
>PRK02110 disulfide bond formation protein B; Provisional Back     alignment and domain information
>PRK01749 disulfide bond formation protein B; Provisional Back     alignment and domain information
>COG1495 DsbB Disulfide bond formation protein DsbB [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04307 putative disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK03113 putative disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK00611 putative disulfide oxidoreductase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target174 hypothetical protein CLIBASIA_01255 [Candidatus Liberib
3e9j_C182 Structure Of The Charge-Transfer Intermediate Of Th 8e-12
2hi7_B176 Crystal Structure Of Dsba-Dsbb-Ubiquinone Complex L 1e-10
2zuq_A176 Crystal Structure Of Dsbb-Fab Complex Length = 176 2e-10
2k73_A183 Solution Nmr Structure Of Integral Membrane Protein 4e-10
>gi|215261264|pdb|3E9J|C Chain C, Structure Of The Charge-Transfer Intermediate Of The Transmembrane Redox Catalyst Dsbb Length = 182 Back     alignment and structure
 Score = 74.0 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 26/169 (15%), Positives = 56/169 (33%), Gaps = 6/169 (3%)

Query: 1   MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALV 60
           M++ L           ++      + +  L  QHV    PC LCI E+   +     AL+
Sbjct: 1   MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERVALFGVLGAALI 60

Query: 61  ADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITS 120
             ++ +    Y +  + L       F  + ++  H  +        A C    +      
Sbjct: 61  GAIAPKTPLRYVAMVIWLY----SAFRGVQLTYEHT-MLQLYPSPFATCDFMVRFPEWLP 115

Query: 121 TVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLK 169
               + Q+   +   C +     LGL +  W + +      +  + ++ 
Sbjct: 116 LDKWVPQVFVAS-GDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVIS 163


>gi|119389881|pdb|2HI7|B Chain B, Crystal Structure Of Dsba-Dsbb-Ubiquinone Complex Length = 176 Back     alignment and structure
>gi|226887666|pdb|2ZUQ|A Chain A, Crystal Structure Of Dsbb-Fab Complex Length = 176 Back     alignment and structure
>gi|209156356|pdb|2K73|A Chain A, Solution Nmr Structure Of Integral Membrane Protein Dsbb Length = 183 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target174 hypothetical protein CLIBASIA_01255 [Candidatus Liberib
2zuq_A176 Disulfide bond formation protein B; disulfide bond, mem 4e-13
>2zuq_A Disulfide bond formation protein B; disulfide bond, membrane protein, E. coli, cell inner membrane, cell membrane, chaperone, electron transport, membrane; HET: UQ1; 3.30A {Escherichia coli} PDB: 3e9j_C* 2hi7_B* 2zup_B* 2k73_A 2k74_A* Length = 176 Back     alignment and structure
 Score = 69.3 bits (169), Expect = 4e-13
 Identities = 21/158 (13%), Positives = 45/158 (28%), Gaps = 6/158 (3%)

Query: 17  IILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRL 76
           ++      + +  L  QHV    P  LCI E+   +     AL+               +
Sbjct: 17  LMAFTALALELTALWFQHVMLLKPSVLCIYERVALFGVLGAALI----GAIAPKTPLRYV 72

Query: 77  LLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSC 136
            ++      F  + ++  H  ++                E     +D            C
Sbjct: 73  AMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPE--WLPLDKWVPQVFVASGDC 130

Query: 137 NKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK 174
            +     LGL +  W + +      +  + ++    K 
Sbjct: 131 AERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKA 168


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target174 hypothetical protein CLIBASIA_01255 [Candidatus Liberib
2zuq_A176 Disulfide bond formation protein B; disulfide bond, mem 100.0
>2zuq_A Disulfide bond formation protein B; disulfide bond, membrane protein, E. coli, cell inner membrane, cell membrane, chaperone, electron transport, membrane; HET: UQ1; 3.30A {Escherichia coli} PDB: 3e9j_C* 2hi7_B* 2zup_B* 2k73_A 2k74_A* Back     alignment and structure
Probab=100.00  E-value=7.8e-39  Score=250.88  Aligned_cols=168  Identities=14%  Similarity=0.119  Sum_probs=134.2

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH
Q ss_conf             96899999642169999999999999999999995278870557998999999999999999972011111012259999
Q gi|255764466|r    1 MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMT   80 (174)
Q Consensus         1 m~~~~~~~~~~~~l~li~~l~~~~ll~~A~~~qy~~gl~PC~LCi~QR~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~~   80 (174)
                      |++-+.+....+..-+++++.++++++.|+|+||++|++|||||++||+||+.++++++++++.++    +...+.....
T Consensus         1 m~~~l~~~~~~R~~~ll~~l~s~~~l~~A~~~q~~~gl~PC~LCi~QR~~~~~i~~~~li~~~~~~----~~~~~~~~~~   76 (176)
T 2zuq_A            1 MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPSVLCIYERVALFGVLGAALIGAIAPK----TPLRYVAMVI   76 (176)
T ss_dssp             ---------CCSHHHHHHHHHTHHHHHHHHHHHHTSCCCCCTTHHHHHHHHHHHHHHHHHHHSSCC----SSTHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCC----HHHHHHHHHH
T ss_conf             978999889887999999999999999999999980888868699999999999999999998320----0489999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             99999999999998658875000101122223431000265889999842899984710033210146889999999999
Q gi|255764466|r   81 LGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLS  160 (174)
Q Consensus        81 ~~l~~~~g~~ia~yH~giE~~~~~~~~~C~~~~~~~~~~~~~~l~~~l~~~~~~~C~ev~w~flGlSma~wn~i~~~~l~  160 (174)
                      ..+.++.|.++|.||+|+|+++++++. |++..+..+..+.+++.+.+.. +.++|||++|+|+|+|||+||+++|++++
T Consensus        77 ~~l~~~~g~~~a~~h~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~-~~~~C~e~~w~~lGlSma~wnli~~~~l~  154 (176)
T 2zuq_A           77 WLYSAFRGVQLTYEHTMLQLYPSPFAT-CDFMVRFPEWLPLDKWVPQVFV-ASGDCAERQWDFLGLEMPQWLLGIFIAYL  154 (176)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHSCCSSCC-CCCCC-----CCSSTTCSTTTC-CCCCCCSCCCCSTTSCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCC-CCCCCCCCCCCCHHHHHHHHCC-CCCCCCCCCHHHCCCCHHHHHHHHHHHHH
T ss_conf             999999999999999999817764434-5642244445789999888227-89884530088726679999999999999


Q ss_pred             HHHHHHHHHHCCCC
Q ss_conf             99999999420379
Q gi|255764466|r  161 FITSIAMLKISRKK  174 (174)
Q Consensus       161 ~i~~~~~~~~~kkk  174 (174)
                      +++.+..++..+|+
T Consensus       155 ~~~~~~l~~~~~~~  168 (176)
T 2zuq_A          155 IVAVLVVISQPFKA  168 (176)
T ss_dssp             HHHTTTTC------
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999986334




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 174 hypothetical protein CLIBASIA_01255 [Candidatus Liberib
d2hi7b1149 a.29.15.1 (B:14-162) Disulfide bond formation protein D 4e-09
>d2hi7b1 a.29.15.1 (B:14-162) Disulfide bond formation protein DsbB {Escherichia coli [TaxId: 562]} Length = 149 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: DsbB-like
family: DsbB-like
domain: Disulfide bond formation protein DsbB
species: Escherichia coli [TaxId: 562]
 Score = 55.1 bits (132), Expect = 4e-09
 Identities = 20/152 (13%), Positives = 44/152 (28%), Gaps = 6/152 (3%)

Query: 17  IILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRL 76
           ++      + +  L  QHV    PC LCI E+   +     AL+               +
Sbjct: 4   LMAFTALALELTALWFQHVMLLKPCVLCIYERVALFGVLGAALI----GAIAPKTPLRYV 59

Query: 77  LLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSC 136
            ++      F  + ++  H  ++                E     +D             
Sbjct: 60  AMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPE--WLPLDKWVPQVFVASGDS 117

Query: 137 NKTTLYVLGLSLAFWNIIVSFFLSFITSIAML 168
            +     LGL +  W + +      +  + ++
Sbjct: 118 AERQWDFLGLEMPQWLLGIFIAYLIVAVLVVI 149


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target174 hypothetical protein CLIBASIA_01255 [Candidatus Liberib
d2hi7b1149 Disulfide bond formation protein DsbB {Escherichia coli 100.0
>d2hi7b1 a.29.15.1 (B:14-162) Disulfide bond formation protein DsbB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: DsbB-like
family: DsbB-like
domain: Disulfide bond formation protein DsbB
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=9.7e-37  Score=236.91  Aligned_cols=146  Identities=14%  Similarity=0.151  Sum_probs=121.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999995278870557998999999999999999972011111012259999999999999999986
Q gi|255764466|r   16 RIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIH   95 (174)
Q Consensus        16 li~~l~~~~ll~~A~~~qy~~gl~PC~LCi~QR~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~~~~l~~~~g~~ia~yH   95 (174)
                      +++++.|..+++.|+|+||++|++|||||++||+||+.++.+++++++.+++    ..++.......+.+..|+++|.||
T Consensus         3 l~~~~~s~~~l~~A~~~q~~~gl~PC~LCi~QR~~~~~i~~~~ll~~~~~~~----~~~~~~~~~~~l~~~~G~~~a~~h   78 (149)
T d2hi7b1           3 LLMAFTALALELTALWFQHVMLLKPCVLCIYERVALFGVLGAALIGAIAPKT----PLRYVAMVIWLYSAFRGVQLTYEH   78 (149)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTSCCCCCSHHHHHHHHHHTTTHHHHTTTTSSSS----SCTHHHHHHTTHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999818887477999999999999999999982045----699999999999999999999999


Q ss_pred             HHHHHCCHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             588750001011222234310002658899998428999847100332101468899999999999999999
Q gi|255764466|r   96 VGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAM  167 (174)
Q Consensus        96 ~giE~~~~~~~~~C~~~~~~~~~~~~~~l~~~l~~~~~~~C~ev~w~flGlSma~wn~i~~~~l~~i~~~~~  167 (174)
                      +|+|+++++ ..+|+++.+..+..+.++..+++. .+.++|||++|+|+|+|||+||+++|+.+++++.+.+
T Consensus        79 ~~~~~~~~~-~~~c~~~~~~~~~~~~~~~~~~~~-~~~~~C~e~~w~~lGlSma~wn~i~~~~~~~~~~~~l  148 (149)
T d2hi7b1          79 TMLQLYPSP-FATCDFMVRFPEWLPLDKWVPQVF-VASGDSAERQWDFLGLEMPQWLLGIFIAYLIVAVLVV  148 (149)
T ss_dssp             HHHTTSCCS-SCCCCCCCCCTTSCGGGGSSTTGG-GC---------------CHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHCCCC-CCCCCCCCCCCCCCCHHHHHHHHH-CCCCCCCCCCCHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             998851356-765564111002287999999973-7898765436254361799999999999999999998



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 174 hypothetical protein CLIBASIA_01255 [Candidatus Li
2zuq_A_176 (A:) Disulfide bond formation protein B; disulfide 2e-14
>2zuq_A (A:) Disulfide bond formation protein B; disulfide bond, membrane protein, E. coli, cell inner membrane, cell membrane, chaperone, electron transport, membrane; HET: UQ1; 3.30A {Escherichia coli} PDB: 3e9j_C* 2hi7_B* 2zup_B* 2k73_A 2k74_A*Length = 176 Back     alignment and structure
 Score = 73.5 bits (180), Expect = 2e-14
 Identities = 24/174 (13%), Positives = 50/174 (28%), Gaps = 10/174 (5%)

Query: 5   LLSTLANIPLPRIILLNISGVIVCFLMI----QHVGGYPPCDLCIQEQKIYYFGFLIALV 60
           +L  L      R   L ++   +   +     QHV    P  LCI E+   +     AL+
Sbjct: 1   MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPSVLCIYERVALFGVLGAALI 60

Query: 61  ADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITS 120
             +            + ++      F  + ++  H  ++                E    
Sbjct: 61  GAI----APKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPE--WL 114

Query: 121 TVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK 174
            +D            C +     LGL +  W + +      +  + ++    K 
Sbjct: 115 PLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKA 168


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target174 hypothetical protein CLIBASIA_01255 [Candidatus Liberib
2zuq_A_176 Disulfide bond formation protein B; disulfide bond 100.0
3kp9_A_1-185185 Vkorc1/thioredoxin domain protein; warfarin, disul 93.48
>2zuq_A (A:) Disulfide bond formation protein B; disulfide bond, membrane protein, E. coli, cell inner membrane, cell membrane, chaperone, electron transport, membrane; HET: UQ1; 3.30A {Escherichia coli} PDB: 3e9j_C* 2hi7_B* 2zup_B* 2k73_A 2k74_A* Back     alignment and structure
Probab=100.00  E-value=2.9e-36  Score=236.37  Aligned_cols=168  Identities=13%  Similarity=0.089  Sum_probs=143.0

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH
Q ss_conf             96899999642169999999999999999999995278870557998999999999999999972011111012259999
Q gi|255764466|r    1 MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLMT   80 (174)
Q Consensus         1 m~~~~~~~~~~~~l~li~~l~~~~ll~~A~~~qy~~gl~PC~LCi~QR~py~~~i~i~l~~~l~~~~~~~~~~~~~~~~~   80 (174)
                      |++++++....+....+..+.+.++++.|+|+||++|++|||||++||+||+.++++++++.+.++    +...+.....
T Consensus         1 m~~~l~~~~~~r~~~~l~~l~~~~~l~~A~~~q~~~~~~PC~LCi~QR~~~~~~~~~~ll~~~~~~----~~~~~~~~~l   76 (176)
T 2zuq_A            1 MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPSVLCIYERVALFGVLGAALIGAIAPK----TPLRYVAMVI   76 (176)
T ss_dssp             ---------CCSHHHHHHHHHTHHHHHHHHHHHHTSCCCCCTTHHHHHHHHHHHHHHHHHHHSSCC----SSTHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCC----CHHHHHHHHH
T ss_conf             978999889886999999999999999999999981898747599999999999999999998121----0389999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             99999999999998658875000101122223431000265889999842899984710033210146889999999999
Q gi|255764466|r   81 LGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLS  160 (174)
Q Consensus        81 ~~l~~~~g~~ia~yH~giE~~~~~~~~~C~~~~~~~~~~~~~~l~~~l~~~~~~~C~ev~w~flGlSma~wn~i~~~~l~  160 (174)
                      ..+.++.|+++|.||+|+|+++|+++..| +.....+..+.+++.+. ...+.++|||++|+|+|+|||+||+++|++++
T Consensus        77 ~~~~a~~G~~~a~~h~~l~~~~~~~~~~~-~~~~~~~~~~~~~~~~~-~~~~~~~C~~~~~~~lGlsm~~ws~i~f~~~~  154 (176)
T 2zuq_A           77 WLYSAFRGVQLTYEHTMLQLYPSPFATCD-FMVRFPEWLPLDKWVPQ-VFVASGDCAERQWDFLGLEMPQWLLGIFIAYL  154 (176)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHSCCSSCCCC-CCC-----CCSSTTCST-TTCCCCCCCSCCCCSTTSCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCC-CCCCCCCCCCHHHHHHH-HHCCCCCCCCCCHHHCCCCHHHHHHHHHHHHH
T ss_conf             99999999999999999983235566676-21134332779999888-30689885544536445579999999999999


Q ss_pred             HHHHHHHHHHCCCC
Q ss_conf             99999999420379
Q gi|255764466|r  161 FITSIAMLKISRKK  174 (174)
Q Consensus       161 ~i~~~~~~~~~kkk  174 (174)
                      +++....+|..|++
T Consensus       155 ~~~~~~~~~~~~~~  168 (176)
T 2zuq_A          155 IVAVLVVISQPFKA  168 (176)
T ss_dssp             HHHTTTTC------
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999987533



>3kp9_A (A:1-185) Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreductase, blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure