254780367

254780367

ribonuclease protein

GeneID in NCBI database:8209352Locus tag:CLIBASIA_01260
Protein GI in NCBI database:254780367Protein Accession:YP_003064780.1
Gene range:-(264875, 265720)Protein Length:281aa
Gene description:ribonuclease protein
COG prediction:[S] Predicted membrane protein
KEGG prediction:ribonuclease protein; K07058
SEED prediction:Ribonuclease BN (EC 3.1.-.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA processing
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM6 TM-Helix
TOPPRED6 TM-Helix
HMMTOP7 TM-Helix
MEMSAT4 TM-Helix
MEMSAT_SVM5 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP
ccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGAnlagflgahqfvptVIDVVFgawpeviakpitDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP
MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP
MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP
**EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM**Y******
MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP
MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
oooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP
MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP
MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target281 ribonuclease protein [Candidatus Liberibacter asiaticus
315121834284 ribonuclease protein [Candidatus Liberibacter solanacea 1 1e-129
222087339310 ribonuclease protein [Agrobacterium radiobacter K84] Le 1 3e-82
86359370307 putative ribonuclease protein [Rhizobium etli CFN 42] L 1 5e-80
190893623307 ribonuclease [Rhizobium etli CIAT 652] Length = 307 1 6e-79
241206535307 ribonuclease BN [Rhizobium leguminosarum bv. trifolii W 1 1e-78
116254049307 transmembrane ribonuclease protein [Rhizobium leguminos 1 1e-78
332716378305 ribonuclease [Agrobacterium sp. H13-3] Length = 305 1 7e-78
209551132307 ribonuclease BN [Rhizobium leguminosarum bv. trifolii W 1 7e-78
218663736307 putative ribonuclease protein [Rhizobium etli IE4771] L 1 1e-77
159185810305 transporter [Agrobacterium tumefaciens str. C58] Length 1 2e-77
>gi|315121834|ref|YP_004062323.1| ribonuclease protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 284 Back     alignment and organism information
 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/280 (80%), Positives = 255/280 (91%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M++YF I+F+I+YDA+EHFVEEDGWAMASHISL+ALLSVFPFIVF ANLAGFLGAH+FVP
Sbjct: 1   MQKYFGIIFNIVYDAVEHFVEEDGWAMASHISLAALLSVFPFIVFCANLAGFLGAHEFVP 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           TVI V FGAWP+VIAKPITDEI QVLAVP KGLFTISALAA YFSSNG+EALR+SLNRAY
Sbjct: 61  TVISVFFGAWPDVIAKPITDEIFQVLAVPRKGLFTISALAAVYFSSNGIEALRVSLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVVEMRSWYITRLIS GYVLLAS+TLVIMSF+FV +PLALAYV+  FP+LGN++ I+WNG
Sbjct: 121 RVVEMRSWYITRLISLGYVLLASITLVIMSFIFVVVPLALAYVKTLFPSLGNMVEIVWNG 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R+Y  +LALFIGLIFVHLFLPA K K+  +LPG+IFT ISW++GAVLFTHYIVTFSTYS 
Sbjct: 181 RLYGAVLALFIGLIFVHLFLPAGKRKVWIVLPGIIFTSISWLIGAVLFTHYIVTFSTYSA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           MYAGLASI  CLVFLYMLGV FI+GAE+NAS II+YW K+
Sbjct: 241 MYAGLASITICLVFLYMLGVIFIIGAEINASTIIHYWEKR 280


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222087339|ref|YP_002545876.1| ribonuclease protein [Agrobacterium radiobacter K84] Length = 310 Back     alignment and organism information
>gi|86359370|ref|YP_471262.1| putative ribonuclease protein [Rhizobium etli CFN 42] Length = 307 Back     alignment and organism information
>gi|190893623|ref|YP_001980165.1| ribonuclease [Rhizobium etli CIAT 652] Length = 307 Back     alignment and organism information
>gi|241206535|ref|YP_002977631.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 307 Back     alignment and organism information
>gi|116254049|ref|YP_769887.1| transmembrane ribonuclease protein [Rhizobium leguminosarum bv. viciae 3841] Length = 307 Back     alignment and organism information
>gi|332716378|ref|YP_004443844.1| ribonuclease [Agrobacterium sp. H13-3] Length = 305 Back     alignment and organism information
>gi|209551132|ref|YP_002283049.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 307 Back     alignment and organism information
>gi|218663736|ref|ZP_03519666.1| putative ribonuclease protein [Rhizobium etli IE4771] Length = 307 Back     alignment and organism information
>gi|159185810|ref|NP_357022.2| transporter [Agrobacterium tumefaciens str. C58] Length = 305 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target281 ribonuclease protein [Candidatus Liberibacter asiaticus
pfam03631255 pfam03631, Ribonuclease_BN, Ribonuclease BN-like family 3e-29
TIGR00765259 TIGR00765, yihY_not_rbn, YihY family protein (not ribon 2e-13
COG1295303 COG1295, Rbn, Predicted membrane protein [Function unkn 5e-31
PRK04214 412 PRK04214, rbn, ribonuclease BN/unknown domain fusion pr 2e-06
>gnl|CDD|146329 pfam03631, Ribonuclease_BN, Ribonuclease BN-like family Back     alignment and domain information
>gnl|CDD|129848 TIGR00765, yihY_not_rbn, YihY family protein (not ribonuclease BN) Back     alignment and domain information
>gnl|CDD|31486 COG1295, Rbn, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|179791 PRK04214, rbn, ribonuclease BN/unknown domain fusion protein; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 281 ribonuclease protein [Candidatus Liberibacter asiaticus
PRK01637284 rbn ribonuclease BN; Reviewed 100.0
COG1295303 Rbn Ribonuclease BN family enzyme [Replication, recombi 100.0
PRK04214 411 rbn ribonuclease BN/unknown domain fusion protein; Revi 100.0
pfam03631255 Ribonuclease_BN Ribonuclease BN-like family. This famil 100.0
TIGR00765268 yihY_not_rbn YihY family protein; InterPro: IPR004664 M 100.0
TIGR00766299 TIGR00766 ribonuclease, putative; InterPro: IPR005274 M 99.71
>PRK01637 rbn ribonuclease BN; Reviewed Back     alignment and domain information
>COG1295 Rbn Ribonuclease BN family enzyme [Replication, recombination, and repair] Back     alignment and domain information
>PRK04214 rbn ribonuclease BN/unknown domain fusion protein; Reviewed Back     alignment and domain information
>pfam03631 Ribonuclease_BN Ribonuclease BN-like family Back     alignment and domain information
>TIGR00765 yihY_not_rbn YihY family protein; InterPro: IPR004664 Members of this entry include ribonuclease BN (rbn) from Escherichia coli and homologues from a number of bacteria, including the largely uncharacterised BrkB (Bordetella spp Back     alignment and domain information
>TIGR00766 TIGR00766 ribonuclease, putative; InterPro: IPR005274 Members of this family show similarity to ribonuclease BN and include the Escherichia coli protein YhjD is located in the inner membrane Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target281 ribonuclease protein [Candidatus Liberibacter asiaticus
d2r6gf1 248 Maltose transport system permease protein MalF {Escheri 91.33
>d2r6gf1 e.70.1.1 (F:13-260) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: MalF N-terminal region-like
superfamily: MalF N-terminal region-like
family: MalF N-terminal region-like
domain: Maltose transport system permease protein MalF
species: Escherichia coli [TaxId: 562]
Probab=91.33  E-value=0.23  Score=21.70  Aligned_cols=57  Identities=18%  Similarity=0.194  Sum_probs=42.7

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH
Q ss_conf             99999999999999984057776752101221899999999999999999986522246
Q gi|254780367|r  182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST  240 (281)
Q Consensus       182 ~~~~~l~~~~~~~~~y~~~P~~~~~~~~~~~Ga~~a~v~~~~~~~~f~~y~~~~~~~~~  240 (281)
                      |....+...+.....|-+..++..++|+..||-++- +.+.+.-.+++.|++ +.||+.
T Consensus        28 ~~~a~~~~~~~~~~~~vy~s~r~~p~kyi~PG~~~l-~~Fvi~Pi~yT~~ia-FTNy~t   84 (248)
T d2r6gf1          28 YLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGM-GLFVLFPLVCTIAIA-FTNYSS   84 (248)
T ss_dssp             HHHHHHHHHHHHHHHHHHSSSCCTTHHHHHHHHHHH-HHHTHHHHHHHHHGG-GBCCSS
T ss_pred             HHHHHHHHHHHHHEEEEEECCCCCCEEHHHHHHHHH-HHHHHHHHEEEEEEE-EEECCC
T ss_conf             999999999988527999726764110122389999-999997540588898-898478



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00