255764474

255764474

glycosyl transferase group 1

GeneID in NCBI database:8209427Locus tag:CLIBASIA_01630
Protein GI in NCBI database:255764474Protein Accession:YP_003064854.2
Gene range:+(350327, 351385)Protein Length:352aa
Gene description:glycosyl transferase group 1
COG prediction:[M] Glycosyltransferase
KEGG prediction:glycosyl transferase group 1; K12989 mannosyltransferase [EC:2.4.1.-]
SEED prediction:Glycosyltransferase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MDMNNIDVIAPNMKFRHTGVTSTVFGLCPIQRKLGQRLVVFGYCLPKNIPSIGISSLLTCWKKPIGQNSRIWHARRNNEMLLGVMMRDVLRMPLKLVFTSPSQRNHSRWTRYLISRMDEVITTSQKSARFIERPSTVIMHGVDTERFRPTSNKQEARRHLKISEDAKLIGCFGRIRKLKGTDLFVDCMINILPHHPGWTAVVVGKTTLKHYLFKKNLQRRIYANGLKKRILFIDEQSSIEDWYRALNIFVAPPLYEGFGLTPLEAMASGIPVVASNTGVFSELLDPENAKAGVIVPPRNLHALEKAVLYFMNSKKIMSDTGNRGRERAVKHFSIVKEASDIGKVYDRLLRTA
ccHHHcEEEccccccccccHHHHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHccEEEEccHHHHHHHcccEEEEcccccHHHccccccHHHHHHHcccccccEEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHccEEEEccccccccHHHHHHHHccccEEEEccccHHHHcccccccEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcc
ccHHHHHEEccccccccccHHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHcccccccccEEEcccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHcEEEEEcHHHHHHHHcccEEEcccccHHHccccccHHHHHHHHccccccEEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHccEEEEccccccccHHHHHHHHccccEEEEccccccEEEEEccccEEEEEccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcc
mdmnnidviapnmkfrhtgvtstvfglcpiqrklGQRLVVFGyclpknipsigisslltcwkkpigqnsriWHARRNNEMLLGVMMRDVLRMplklvftspsqrnhsRWTRYLISRMDEVITTsqksarfierpstvimhgvdterfrptsnkQEARRHLKISEDAKLIGCFgrirklkgtdlFVDCMinilphhpgwtAVVVGKTTLKHYLFKKNLQRRIYANGLKKRILFIDEQSSIEDWYRALNIfvapplyegfgltpleamasgipvvasntgvfselldpenakagvivpprnlHALEKAVLYFMNSKKimsdtgnrgreRAVKHFSIVKEASDIGKVYDRLLRTA
MDMNNIDVIapnmkfrhtGVTSTVFGLCPIQRKLGQRLVVFGYCLPKNIPSIGISSLLTCWKKPIGQNSRIWHARRNNEMLLGVMMRDVLRMPLKLvftspsqrnhsrwTRYLISRMDEVIttsqksarfierpstvimhgvdterfrptsnkqearrhlkisedakligcFGRIRKLKGTDLFVDCMINILPHHPGWTAVVVGKTTLKHYLFKKNLQRRIYANGLKKRILFIDEQSSIEDWYRALNIFVAPPLYEGFGLTPLEAMASGIPVVASNTGVFSELLDPENAKAGVIVPPRNLHALEKAVLYFMNSKKimsdtgnrgreRAVKHfsivkeasdigkvYDRLLRTA
MDMNNIDVIAPNMKFRHTGVTSTVFGLCPIQRKLGQRLVVFGYCLPKNIPSIGISSLLTCWKKPIGQNSRIWHARRNNEMLLGVMMRDVLRMPLKLVFTSPSQRNHSRWTRYLISRMDEVITTSQKSARFIERPSTVIMHGVDTERFRPTSNKQEARRHLKISEDAKLIGCFGRIRKLKGTDLFVDCMINILPHHPGWTAVVVGKTTLKHYLFKKNLQRRIYANGLKKRILFIDEQSSIEDWYRALNIFVAPPLYEGFGLTPLEAMASGIPVVASNTGVFSELLDPENAKAGVIVPPRNLHALEKAVLYFMNSKKIMSDTGNRGRERAVKHFSIVKEASDIGKVYDRLLRTA
***NNIDVIAPNMKFRHTGVTSTVFGLCPIQRKLGQRLVVFGYCLPKNIPSIGISSLLTCWKKPIGQNSRIWHARRNNEMLLGVMMRDVLRMPLKLVFTSPSQRNHSRWTRYLISRMDEVITTSQKSARFIERPSTVIMHGVDTERFRPTSNKQEARRHLKISEDAKLIGCFGRIRKLKGTDLFVDCMINILPHHPGWTAVVVGKTTLKHYLFKKNLQRRIYANGLKKRILFIDEQSSIEDWYRALNIFVAPPLYEGFGLTPLEAMASGIPVVASNTGVFSELLDPENAKAGVIVPPRNLHALEKAVLYFMNSKKIMSDTGNRGRERAVKHFSIVKEASDIGKVYDRLLRT*
MDMNNIDVIAPNMKFRHTGVTSTVFGLCPIQRKLGQRLVVFGYCLPKNIPSIGISSLLTCWKKPIGQNSRIWHARRNNEMLLGVMMRDVLRMPLKLVFTSPSQRNHSRWTRYLISRMDEVITTSQKSARFIERPSTVIMHGVDTERFR**********HLKISEDAKLIGCFGRIRKLKGTDLFVDCMINILPHHPGWTAVVVGKTTLKHYLFKKNLQRRIYANGLKKRILFIDEQSSIEDWYRALNIFVAPPLYEGFGLTPLEAMASGIPVVASNTGVFSELLDPENAKAGVIVPPRNLHALEKAVLYFMNSKKIMSDTGNRGRERAVKHFSIVKEASDIGKVYDRLLRTA
MDMNNIDVIAPNMKFRHTGVTSTVFGLCPIQRKLGQRLVVFGYCLPKNIPSIGISSLLTCWKKPIGQNSRIWHARRNNEMLLGVMMRDVLRMPLKLVFTSPSQRNHSRWTRYLISRMDEVITTSQKSARFIERPSTVIMHGVDTERFRPTSNKQEARRHLKISEDAKLIGCFGRIRKLKGTDLFVDCMINILPHHPGWTAVVVGKTTLKHYLFKKNLQRRIYANGLKKRILFIDEQSSIEDWYRALNIFVAPPLYEGFGLTPLEAMASGIPVVASNTGVFSELLDPENAKAGVIVPPRNLHALEKAVLYFMNSKKIMSDTGNRGRERAVKHFSIVKEASDIGKVYDRLLRT*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDMNNIDVIAPNMKFRHTGVTSTVFGLCPIQRKLGQRLVVFGYCLPKNIPSIGISSLLTCWKKPIGQNSRIWHARRNNEMLLGVMMRDVLRMPLKLVFTSPSQRNHSRWTRYLISRMDEVITTSQKSARFIERPSTVIMHGVDTERFRPTSNKQEARRHLKISEDAKLIGCFGRIRKLKGTDLFVDCMINILPHHPGWTAVVVGKTTLKHYLFKKNLQRRIYANGLKKRILFIDEQSSIEDWYRALNIFVAPPLYEGFGLTPLEAMASGIPVVASNTGVFSELLDPENAKAGVIVPPRNLHALEKAVLYFMNSKKIMSDTGNRGRERAVKHFSIVKEASDIGKVYDRLLRTA
MDMNNIDVIAPNMKFRHTGVTSTVFGLCPIQRKLGQRLVVFGYCLPKNIPSIGISSLLTCWKKPIGQNSRIWHARRNNEMLLGVMMRDVLRMPLKLVFTSPSQRNHSRWTRYLISRMDEVITTSQKSARFIERPSTVIMHGVDTERFRPTSNKQEARRHLKISEDAKLIGCFGRIRKLKGTDLFVDCMINILPHHPGWTAVVVGKTTLKHYLFKKNLQRRIYANGLKKRILFIDEQSSIEDWYRALNIFVAPPLYEGFGLTPLEAMASGIPVVASNTGVFSELLDPENAKAGVIVPPRNLHALEKAVLYFMNSKKIMSDTGNRGRERAVKHFSIVKEASDIGKVYDRLLRTA
MDMNNIDVIAPNMKFRHTGVTSTVFGLCPIQRKLGQRLVVFGYCLPKNIPSIGISSLLTCWKKPIGQNSRIWHARRNNEMLLGVMMRDVLRMPLKLVFTSPSQRNHSRWTRYLISRMDEVITTSQKSARFIERPSTVIMHGVDTERFRPTSNKQEARRHLKISEDAKLIGCFGRIRKLKGTDLFVDCMINILPHHPGWTAVVVGKTTLKHYLFKKNLQRRIYANGLKKRILFIDEQSSIEDWYRALNIFVAPPLYEGFGLTPLEAMASGIPVVASNTGVFSELLDPENAKAGVIVPPRNLHALEKAVLYFMNSKKIMSDTGNRGRERAVKHFSIVKEASDIGKVYDRLLRTA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target352 glycosyl transferase group 1 [Candidatus Liberibacter a
315122110367 glycosyl transferase group 1 [Candidatus Liberibacter s 1 1e-153
227822119351 lipopolysaccharide core biosynthesis mannosyltransferas 1 1e-105
307317182351 glycosyl transferase group 1 [Sinorhizobium meliloti AK 1 1e-101
150396471351 group 1 glycosyl transferase [Sinorhizobium medicae WSM 1 1e-101
15965325351 putative lipopolysaccharide core biosynthesis mannosylt 1 1e-101
319403839352 lipopolysaccharide core biosynthesis mannosyltransferas 1 4e-90
319406849352 lipopolysaccharide core biosynthesis mannosyltransferas 1 5e-88
319405278352 lipopolysaccharide core biosynthesis mannosyltransferas 1 2e-87
319898513352 lipopolysaccharide core biosynthesis mannosyltransferas 1 4e-86
319408895352 lipopolysaccharide core biosynthesis mannosyltransferas 1 2e-84
>gi|315122110|ref|YP_004062599.1| glycosyl transferase group 1 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 367 Back     alignment and organism information
 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 255/348 (73%), Positives = 300/348 (86%)

Query: 1   MDMNNIDVIAPNMKFRHTGVTSTVFGLCPIQRKLGQRLVVFGYCLPKNIPSIGISSLLTC 60
           +DM+NIDVI PN+K RH+GVTST+FGL PIQRK+GQRLVVFGY LPKNI SIGISSLL C
Sbjct: 20  IDMSNIDVITPNLKIRHSGVTSTIFGLYPIQRKIGQRLVVFGYFLPKNIASIGISSLLAC 79

Query: 61  WKKPIGQNSRIWHARRNNEMLLGVMMRDVLRMPLKLVFTSPSQRNHSRWTRYLISRMDEV 120
           W++PI Q +RIWHARR+NEMLLG++MRDVLRMPLKLVFT+  QR +S+W  +L SRMD V
Sbjct: 80  WRRPISQKNRIWHARRHNEMLLGIVMRDVLRMPLKLVFTTSKQRKNSKWGEFLTSRMDAV 139

Query: 121 ITTSQKSARFIERPSTVIMHGVDTERFRPTSNKQEARRHLKISEDAKLIGCFGRIRKLKG 180
           I TS+KSA     P+T+IMHGV+TERF PT+NK+EARR +++ E+AKLIGCFGRIRKLKG
Sbjct: 140 IATSKKSAYSTNCPNTIIMHGVNTERFHPTNNKKEARRKIQMPENAKLIGCFGRIRKLKG 199

Query: 181 TDLFVDCMINILPHHPGWTAVVVGKTTLKHYLFKKNLQRRIYANGLKKRILFIDEQSSIE 240
           TDLFVDCMIN+LPHHP W A++VG+TTLKH  FKKN+Q+RIY  GL+KRILFI+EQ  I+
Sbjct: 200 TDLFVDCMINLLPHHPEWIALIVGRTTLKHCRFKKNIQKRIYEAGLEKRILFINEQYLID 259

Query: 241 DWYRALNIFVAPPLYEGFGLTPLEAMASGIPVVASNTGVFSELLDPENAKAGVIVPPRNL 300
            WYRAL+IFV+P L EGFGLTPLEAMASG+PVVAS+ G F+ELLDPEN KAG+I PP +L
Sbjct: 260 SWYRALDIFVSPSLSEGFGLTPLEAMASGVPVVASDVGAFTELLDPENTKAGIIFPPGDL 319

Query: 301 HALEKAVLYFMNSKKIMSDTGNRGRERAVKHFSIVKEASDIGKVYDRL 348
           H +EKA+LYFM S  IMSDTGNRGRERAVKHFSI KEA  IG+VYD L
Sbjct: 320 HEMEKAILYFMKSDNIMSDTGNRGRERAVKHFSIEKEALKIGEVYDTL 367


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822119|ref|YP_002826090.1| lipopolysaccharide core biosynthesis mannosyltransferase LpsB [Sinorhizobium fredii NGR234] Length = 351 Back     alignment and organism information
>gi|307317182|ref|ZP_07596623.1| glycosyl transferase group 1 [Sinorhizobium meliloti AK83] Length = 351 Back     alignment and organism information
>gi|150396471|ref|YP_001326938.1| group 1 glycosyl transferase [Sinorhizobium medicae WSM419] Length = 351 Back     alignment and organism information
>gi|15965325|ref|NP_385678.1| putative lipopolysaccharide core biosynthesis mannosyltransferase protein [Sinorhizobium meliloti 1021] Length = 351 Back     alignment and organism information
>gi|319403839|emb|CBI77425.1| lipopolysaccharide core biosynthesis mannosyltransferase LpcC [Bartonella rochalimae ATCC BAA-1498] Length = 352 Back     alignment and organism information
>gi|319406849|emb|CBI80484.1| lipopolysaccharide core biosynthesis mannosyltransferase LpcC [Bartonella sp. 1-1C] Length = 352 Back     alignment and organism information
>gi|319405278|emb|CBI78892.1| lipopolysaccharide core biosynthesis mannosyltransferase LpcC [Bartonella sp. AR 15-3] Length = 352 Back     alignment and organism information
>gi|319898513|ref|YP_004158606.1| lipopolysaccharide core biosynthesis mannosyltransferase LpcC [Bartonella clarridgeiae 73] Length = 352 Back     alignment and organism information
>gi|319408895|emb|CBI82552.1| lipopolysaccharide core biosynthesis mannosyltransferase LpcC [Bartonella schoenbuchensis R1] Length = 352 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target352 glycosyl transferase group 1 [Candidatus Liberibacter a
cd03798377 cd03798, GT1_wlbH_like, This family is most closely rel 6e-41
cd03807365 cd03807, GT1_WbnK_like, This family is most closely rel 4e-37
cd03808359 cd03808, GT1_cap1E_like, This family is most closely re 1e-29
cd03800398 cd03800, GT1_Sucrose_synthase, This family is most clos 3e-29
cd03821375 cd03821, GT1_Bme6_like, This family is most closely rel 5e-29
cd03825365 cd03825, GT1_wcfI_like, This family is most closely rel 2e-28
cd03809365 cd03809, GT1_mtfB_like, This family is most closely rel 1e-23
cd03817374 cd03817, GT1_UGDG_like, This family is most closely rel 5e-22
cd03814364 cd03814, GT1_like_2, This family is most closely relate 1e-21
cd03811353 cd03811, GT1_WabH_like, This family is most closely rel 1e-21
cd03813475 cd03813, GT1_like_3, This family is most closely relate 1e-18
cd03799355 cd03799, GT1_amsK_like, This is a family of GT1 glycosy 2e-17
cd04962371 cd04962, GT1_like_5, This family is most closely relate 1e-16
cd03795357 cd03795, GT1_like_4, This family is most closely relate 2e-16
cd03794394 cd03794, GT1_wbuB_like, This family is most closely rel 2e-16
cd03804351 cd03804, GT1_wbaZ_like, This family is most closely rel 9e-13
KOG1111426 KOG1111, KOG1111, KOG1111, N-acetylglucosaminyltransfer 7e-12
cd03802335 cd03802, GT1_AviGT4_like, This family is most closely r 1e-11
TIGR02149388 TIGR02149, glgA_Coryne, glycogen synthase, Corynebacter 5e-11
PRK10307412 PRK10307, PRK10307, putative glycosyl transferase; Prov 3e-07
cd03796398 cd03796, GT1_PIG-A_like, This family is most closely re 4e-05
COG1519419 COG1519, KdtA, 3-deoxy-D-manno-octulosonic-acid transfe 8e-04
pfam00534172 pfam00534, Glycos_transf_1, Glycosyl transferases group 8e-32
cd04951360 cd04951, GT1_WbdM_like, This family is most closely rel 4e-24
cd03820348 cd03820, GT1_amsD_like, This family is most closely rel 8e-23
TIGR03088374 TIGR03088, stp2, sugar transferase, PEP-CTERM/EpsH1 sys 2e-22
cd03819355 cd03819, GT1_WavL_like, This family is most closely rel 6e-21
TIGR03449405 TIGR03449, mycothiol_MshA, UDP-N-acetylglucosamine: 1L- 1e-18
cd05844367 cd05844, GT1_like_7, Glycosyltransferases catalyze the 4e-15
PLN02871465 PLN02871, PLN02871, UDP-sulfoquinovose:DAG sulfoquinovo 8e-12
cd03823359 cd03823, GT1_ExpE7_like, This family is most closely re 2e-11
COG0297487 COG0297, GlgA, Glycogen synthase [Carbohydrate transpor 2e-06
COG0380486 COG0380, OtsA, Trehalose-6-phosphate synthase [Carbohyd 3e-04
PRK15179694 PRK15179, PRK15179, Vi polysaccharide biosynthesis prot 3e-04
cd03818396 cd03818, GT1_ExpC_like, This family is most closely rel 0.002
COG0438381 COG0438, RfaG, Glycosyltransferase [Cell envelope bioge 1e-27
cd03801374 cd03801, GT1_YqgM_like, This family is most closely rel 4e-47
cd03812358 cd03812, GT1_CapH_like, This family is most closely rel 2e-22
cd01635229 cd01635, Glycosyltransferase_GTB_type, Glycosyltransfer 3e-16
PRK15484380 PRK15484, PRK15484, lipopolysaccharide 1,2-N-acetylgluc 1e-06
PLN02939977 PLN02939, PLN02939, transferase, transferring glycosyl 2e-04
cd03822366 cd03822, GT1_ecORF704_like, This family is most closely 4e-15
cd03791476 cd03791, GT1_Glycogen_synthase_DULL1_like, This family 5e-07
TIGR02095473 TIGR02095, glgA, glycogen/starch synthases, ADP-glucose 2e-05
cd04949372 cd04949, GT1_gtfA_like, This family is most closely rel 4e-11
KOG0853495 KOG0853, KOG0853, KOG0853, Glycosyltransferase [Cell wa 7e-07
cd03793590 cd03793, GT1_Glycogen_synthase_GSY2_like, Glycogen synt 5e-04
KOG3742692 KOG3742, KOG3742, KOG3742, Glycogen synthase [Carbohydr 0.003
cd03792372 cd03792, GT1_Trehalose_phosphorylase, Trehalose phospho 9e-08
cd03805392 cd03805, GT1_ALG2_like, This family is most closely rel 3e-07
TIGR02472439 TIGR02472, sucr_P_syn_N, sucrose-phosphate synthase, pu 4e-07
TIGR02470784 TIGR02470, sucr_synth, sucrose synthase 1e-06
PRK15490578 PRK15490, PRK15490, Vi polysaccharide biosynthesis prot 5e-07
PLN00142815 PLN00142, PLN00142, sucrose synthase 9e-06
TIGR02468 1050 TIGR02468, sucrsPsyn_pln, sucrose phosphate synthase/po 3e-04
>gnl|CDD|99971 cd03798, GT1_wlbH_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99979 cd03807, GT1_WbnK_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99980 cd03808, GT1_cap1E_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99973 cd03800, GT1_Sucrose_synthase, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99991 cd03821, GT1_Bme6_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99994 cd03825, GT1_wcfI_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99981 cd03809, GT1_mtfB_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99987 cd03817, GT1_UGDG_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99985 cd03814, GT1_like_2, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99982 cd03811, GT1_WabH_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99984 cd03813, GT1_like_3, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99972 cd03799, GT1_amsK_like, This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>gnl|CDD|100002 cd04962, GT1_like_5, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99969 cd03795, GT1_like_4, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99968 cd03794, GT1_wbuB_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99976 cd03804, GT1_wbaZ_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|36327 KOG1111, KOG1111, KOG1111, N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase [Cell wall/membrane/envelope biogenesis, Posttranslational modification, protein turnover, chaperones, Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99975 cd03802, GT1_AviGT4_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|162731 TIGR02149, glgA_Coryne, glycogen synthase, Corynebacterium family Back     alignment and domain information
>gnl|CDD|182369 PRK10307, PRK10307, putative glycosyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|99970 cd03796, GT1_PIG-A_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|31708 COG1519, KdtA, 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144209 pfam00534, Glycos_transf_1, Glycosyl transferases group 1 Back     alignment and domain information
>gnl|CDD|100000 cd04951, GT1_WbdM_like, This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>gnl|CDD|99990 cd03820, GT1_amsD_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|132132 TIGR03088, stp2, sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>gnl|CDD|99989 cd03819, GT1_WavL_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|132490 TIGR03449, mycothiol_MshA, UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>gnl|CDD|100003 cd05844, GT1_like_7, Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>gnl|CDD|178460 PLN02871, PLN02871, UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>gnl|CDD|99993 cd03823, GT1_ExpE7_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|30645 COG0297, GlgA, Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|30729 COG0380, OtsA, Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|185101 PRK15179, PRK15179, Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>gnl|CDD|99988 cd03818, GT1_ExpC_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|30787 COG0438, RfaG, Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|99974 cd03801, GT1_YqgM_like, This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>gnl|CDD|99983 cd03812, GT1_CapH_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99959 cd01635, Glycosyltransferase_GTB_type, Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>gnl|CDD|185381 PRK15484, PRK15484, lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>gnl|CDD|178527 PLN02939, PLN02939, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|99992 cd03822, GT1_ecORF704_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99965 cd03791, GT1_Glycogen_synthase_DULL1_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|162700 TIGR02095, glgA, glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>gnl|CDD|99998 cd04949, GT1_gtfA_like, This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>gnl|CDD|36071 KOG0853, KOG0853, KOG0853, Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|99967 cd03793, GT1_Glycogen_synthase_GSY2_like, Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>gnl|CDD|38946 KOG3742, KOG3742, KOG3742, Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|99966 cd03792, GT1_Trehalose_phosphorylase, Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>gnl|CDD|99977 cd03805, GT1_ALG2_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|131525 TIGR02472, sucr_P_syn_N, sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>gnl|CDD|162872 TIGR02470, sucr_synth, sucrose synthase Back     alignment and domain information
>gnl|CDD|185387 PRK15490, PRK15490, Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>gnl|CDD|177747 PLN00142, PLN00142, sucrose synthase Back     alignment and domain information
>gnl|CDD|162870 TIGR02468, sucrsPsyn_pln, sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 352 glycosyl transferase group 1 [Candidatus Liberibacter a
cd03796398 GT1_PIG-A_like This family is most closely related to t 100.0
cd03800398 GT1_Sucrose_synthase This family is most closely relate 100.0
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol 100.0
cd04962371 GT1_like_5 This family is most closely related to the G 100.0
cd03814364 GT1_like_2 This family is most closely related to the G 100.0
cd03817374 GT1_UGDG_like This family is most closely related to th 100.0
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltransfera 100.0
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system associat 100.0
cd03801374 GT1_YqgM_like This family is most closely related to th 100.0
cd04951360 GT1_WbdM_like This family is most closely related to th 100.0
cd03807365 GT1_WbnK_like This family is most closely related to th 100.0
cd03819355 GT1_WavL_like This family is most closely related to th 100.0
cd03798377 GT1_wlbH_like This family is most closely related to th 100.0
TIGR02149416 glgA_Coryne glycogen synthase, Corynebacterium family; 100.0
cd03820348 GT1_amsD_like This family is most closely related to th 100.0
cd03795357 GT1_like_4 This family is most closely related to the G 100.0
cd03808359 GT1_cap1E_like This family is most closely related to t 100.0
cd03811353 GT1_WabH_like This family is most closely related to th 100.0
cd05844367 GT1_like_7 Glycosyltransferases catalyze the transfer o 100.0
cd03822366 GT1_ecORF704_like This family is most closely related t 100.0
cd03812358 GT1_CapH_like This family is most closely related to th 100.0
cd03821375 GT1_Bme6_like This family is most closely related to th 100.0
cd03805392 GT1_ALG2_like This family is most closely related to th 100.0
PRK10307415 predicted glycosyl transferase; Provisional 100.0
cd03823359 GT1_ExpE7_like This family is most closely related to t 100.0
cd03825365 GT1_wcfI_like This family is most closely related to th 100.0
cd03794394 GT1_wbuB_like This family is most closely related to th 100.0
cd03809365 GT1_mtfB_like This family is most closely related to th 100.0
cd04955363 GT1_like_6 This family is most closely related to the G 100.0
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP 100.0
cd03802335 GT1_AviGT4_like This family is most closely related to 100.0
cd03818396 GT1_ExpC_like This family is most closely related to th 100.0
PRK09922361 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-gala 100.0
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is most cl 100.0
PRK00654476 glgA glycogen synthase; Provisional 100.0
cd04946407 GT1_AmsK_like This family is most closely related to th 100.0
KOG1111426 consensus 100.0
cd03804351 GT1_wbaZ_like This family is most closely related to th 100.0
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system associat 100.0
TIGR02472445 sucr_P_syn_N sucrose-phosphate synthase, putative, glyc 100.0
PRK10125405 predicted glycosyl transferase; Provisional 99.97
cd03806419 GT1_ALG11_like This family is most closely related to t 99.97
PRK00726359 murG N-acetylglucosaminyl transferase; Provisional 99.55
PHA01630333 putative group 1 glycosyl transferase 99.51
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferase, th 99.49
PHA01633335 putative glycosyl transferase group 1 99.45
KOG2941444 consensus 99.43
PRK12446352 N-acetylglucosaminyl transferase; Reviewed 99.28
PRK00025382 lpxB lipid-A-disaccharide synthase; Reviewed 99.17
TIGR01133368 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- 98.9
pfam02684373 LpxB Lipid-A-disaccharide synthetase. This is a family 98.73
PRK09814337 hypothetical protein; Provisional 98.63
PRK01021607 lpxB lipid-A-disaccharide synthase; Reviewed 98.29
COG4641373 Uncharacterized protein conserved in bacteria [Function 98.18
COG3980318 spsG Spore coat polysaccharide biosynthesis protein, pr 97.13
cd03813475 GT1_like_3 This family is most closely related to the G 100.0
TIGR02095517 glgA glycogen/starch synthases, ADP-glucose type; Inter 100.0
COG0297487 GlgA Glycogen synthase [Carbohydrate transport and meta 99.94
TIGR02470790 sucr_synth sucrose synthase; InterPro: IPR012820 This e 99.92
TIGR02468 1072 sucrsPsyn_pln sucrose phosphate synthase; InterPro: IPR 99.88
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.77
cd03793590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, whic 99.76
PRK13609388 diacylglycerol glucosyltransferase; Provisional 99.73
pfam05693633 Glycogen_syn Glycogen synthase. This family consists of 99.69
cd03816415 GT1_ALG1_like This family is most closely related to th 99.69
PRK10117474 trehalose-6-phosphate synthase; Provisional 99.6
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glyco 99.58
pfam00982470 Glyco_transf_20 Glycosyltransferase family 20. Members 99.52
PRK05749423 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed 99.51
TIGR02400476 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase 99.48
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell 99.41
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine tr 99.4
TIGR03492396 conserved hypothetical protein. This protein family is 98.82
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelope bio 98.81
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope 98.21
PRK10017426 putative pyruvyl transferase; Provisional 96.78
PRK02797358 4-alpha-L-fucosyltransferase; Provisional 96.54
cd04949372 GT1_gtfA_like This family is most closely related to th 100.0
KOG0853495 consensus 99.94
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis, out 99.9
cd04950373 GT1_like_1 Glycosyltransferases catalyze the transfer o 99.86
KOG1387465 consensus 99.8
TIGR02918511 TIGR02918 conserved hypothetical protein TIGR02918; Int 99.78
COG0380486 OtsA Trehalose-6-phosphate synthase [Carbohydrate trans 99.35
TIGR02398495 gluc_glyc_Psyn glucosylglycerol-phosphate synthase; Int 98.89
KOG1050 732 consensus 97.82
pfam10933364 DUF2827 Protein of unknown function (DUF2827). This is 96.12
pfam00534172 Glycos_transf_1 Glycosyl transferases group 1. Mutation 99.96
COG3914620 Spy Predicted O-linked N-acetylglucosamine transferase, 98.93
cd04299778 GT1_Glycogen_Phosphorylase_like This family is most clo 98.49
TIGR02094618 more_P_ylases alpha-glucan phosphorylases; InterPro: IP 98.3
pfam04101167 Glyco_tran_28_C Glycosyltransferase family 28 C-termina 98.26
cd03784401 GT1_Gtf_like This family includes the Gtfs, a group of 97.87
COG1819406 Glycosyl transferases, related to UDP-glucuronosyltrans 97.65
TIGR01426429 MGT glycosyltransferase, MGT family; InterPro: IPR00632 97.65
pfam04464186 Glyphos_transf CDP-Glycerol:Poly(glycerophosphate) glyc 97.21
KOG4626966 consensus 96.72
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases catal 99.95
pfam04007335 DUF354 Protein of unknown function (DUF354). Members of 97.97
TIGR03609298 S_layer_CsaB polysaccharide pyruvyl transferase CsaB. T 96.81
pfam06258308 DUF1022 Protein of unknown function (DUF1022). This fam 96.31
COG1817346 Uncharacterized protein conserved in archaea [Function 94.72
PRK10422352 lipopolysaccharide core biosynthesis protein; Provision 90.87
KOG3742692 consensus 98.7
pfam00201501 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase. 97.16
COG0058750 GlgP Glucan phosphorylase [Carbohydrate transport and m 98.14
TIGR03590280 PseG pseudaminic acid biosynthesis-associated protein P 97.91
pfam00343712 Phosphorylase Carbohydrate phosphorylase. The members o 97.38
pfam01075249 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltr 96.23
pfam02350346 Epimerase_2 UDP-N-acetylglucosamine 2-epimerase. This f 97.89
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-h 97.66
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP 97.08
pfam07429361 Fuc4NAc_transf 4-alpha-L-fucosyltransferase (Fuc4NAc tr 93.17
pfam09314185 DUF1972 Domain of unknown function (DUF1972). Members o 97.27
pfam08323229 Glyco_transf_5 Starch synthase catalytic domain. 97.2
TIGR02919448 TIGR02919 conserved hypothetical protein TIGR02919; Int 93.78
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family; InterPro: IPR011875 This entry describes Corynebacterium glutamicum GlgA and closely related proteins in other species Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10307 predicted glycosyl transferase; Provisional Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG1111 consensus Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain; InterPro: IPR012822 This family consists of the N-terminal regions, or in some cases the entirety, of bacterial proteins closely related to plant sucrose-phosphate synthases (SPS) Back     alignment and domain information
>PRK10125 predicted glycosyl transferase; Provisional Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00726 murG N-acetylglucosaminyl transferase; Provisional Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>KOG2941 consensus Back     alignment and domain information
>PRK12446 N-acetylglucosaminyl transferase; Reviewed Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; InterPro: IPR006009 The murG gene of Escherichia coli encodes the N-acetylglucosaminyltransferase, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, responsible for the final step in the formation of the lipid-linked disaccharide-pentapeptide subunit of peptidoglycan Back     alignment and domain information
>pfam02684 LpxB Lipid-A-disaccharide synthetase Back     alignment and domain information
>PRK09814 hypothetical protein; Provisional Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>COG4641 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type; InterPro: IPR011835 This family consists of glycogen (or starch) synthases that use ADP-glucose (2 Back     alignment and domain information
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase; InterPro: IPR012820 This entry represents sucrose synthase an enzyme that despite its name, generally uses rather produces sucrose Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase; InterPro: IPR012819 Sucrose occupies a central position in the metabolic pathways of all plants and plays a variety of roles including transport sugar, storage reserve, compatible solute, and signal compound Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>pfam05693 Glycogen_syn Glycogen synthase Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10117 trehalose-6-phosphate synthase; Provisional Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>pfam00982 Glyco_transf_20 Glycosyltransferase family 20 Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming]; InterPro: IPR012766 This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10017 putative pyruvyl transferase; Provisional Back     alignment and domain information
>PRK02797 4-alpha-L-fucosyltransferase; Provisional Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>KOG0853 consensus Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>KOG1387 consensus Back     alignment and domain information
>TIGR02918 TIGR02918 conserved hypothetical protein TIGR02918; InterPro: IPR014267 Members of this entry are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus Back     alignment and domain information
>COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase; InterPro: IPR012764 Glucosylglycerol-phosphate synthase catalyzes the key step in the biosynthesis of the osmolyte glucosylglycerol Back     alignment and domain information
>KOG1050 consensus Back     alignment and domain information
>pfam10933 DUF2827 Protein of unknown function (DUF2827) Back     alignment and domain information
>pfam00534 Glycos_transf_1 Glycosyl transferases group 1 Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases; InterPro: IPR011834 This family consists of known phosphorylases, and homologues believed to share the function of using inorganic phosphate to cleave an alpha 1,4 linkage between the terminal glucose residue and the rest of the polymer (maltodextrin, glycogen, etc Back     alignment and domain information
>pfam04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family; InterPro: IPR006326 These sequences belong to the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family Back     alignment and domain information
>pfam04464 Glyphos_transf CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase Back     alignment and domain information
>KOG4626 consensus Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>pfam04007 DUF354 Protein of unknown function (DUF354) Back     alignment and domain information
>TIGR03609 S_layer_CsaB polysaccharide pyruvyl transferase CsaB Back     alignment and domain information
>pfam06258 DUF1022 Protein of unknown function (DUF1022) Back     alignment and domain information
>COG1817 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG3742 consensus Back     alignment and domain information
>pfam00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>COG0058 GlgP Glucan phosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>pfam00343 Phosphorylase Carbohydrate phosphorylase Back     alignment and domain information
>pfam01075 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltransferase) Back     alignment and domain information
>pfam02350 Epimerase_2 UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>pfam07429 Fuc4NAc_transf 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) Back     alignment and domain information
>pfam09314 DUF1972 Domain of unknown function (DUF1972) Back     alignment and domain information
>pfam08323 Glyco_transf_5 Starch synthase catalytic domain Back     alignment and domain information
>TIGR02919 TIGR02919 conserved hypothetical protein TIGR02919; InterPro: IPR014268 Members of this entry are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcu