255764476

255764476

two-component sensor histidine kinase protein

GeneID in NCBI database:8209831Locus tag:CLIBASIA_03590
Protein GI in NCBI database:255764476Protein Accession:YP_003065238.2
Gene range:+(424002, 426380)Protein Length:792aa
Gene description:two-component sensor histidine kinase protein
COG prediction:[T] Signal transduction histidine kinase
KEGG prediction:two-component sensor histidine kinase protein
SEED prediction:FIG056333: sensor
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790--
MMAGMATIGIGKGIEICTLFSCKIAVFGTIAGMLLTTIIPIILLIRQRNSLAKKVNETYSFLSEICDQLSKYHSLLTENNCLTIVWDGKDETPEIIGQLHQRIDIPQTDTDLLSFENWLKFHHYIKLSKATEKLRKEGQSFDLVAETQNDCAIKIEGRVSGSCAFLRILSLDGIYSELAETTLKCKKLSNHISVFKVLFDSLDFLVWHRDQAGDILWANISYKKNTETEGIVFQKAIGESRKLFKEEIKKRMISSSALEKNFCETVSTLEHGNNKSYKIVRVLNSFGEAGIAIDVSKEITVNDQLTHTYEILHNLTVAIAIFDQNRYLQFHNRSFVELWEIDLAFLATNPSNDELLEFLRSANKLPEQLNWKTWKENIFSVYKSSETHKDTWHLPNGQTLHVIVTSNPRGGTIWMFENLTVQVDLETKYNTLVKVQGETIDHLSEGVAVFGPDGRIKLSNPAFRSLWKTEENRLSPGTHIRNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGTLELLSDSVLEYSIIPLPNAQTMLTFVNVTDSVRAERALTEKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNSKQSQYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIPSKE
ccccccccccccccEEEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHcccHHHHHccccccHHHHccHHHHccHHHHHHHHHHHHHHHHccccEEEEEccccccEEEEccEEcccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccEEEEEcHHHHHHcccccccccccccccHHHcccHHHHHHHHcccccccccEEEEEccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccEEEEcHHHHHHHcccHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccEEEcccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccccEEEEHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccEEEEEEEEccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccEEEEEEEEccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccEEEEEEEccccEEEEEEEEccc
cHHHHHHcccccccEHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccEEccccHHcccccccHHHEEHcccccccHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEEcccEEEEEEHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccEEEEcHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHcccccHEEEEEEEEcccEEEEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHcHHHHHHHcccHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHcccccccEEEEEEcccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccEEEEccHHHHHHHcccHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHcHcHccccccccEEccccEEEEEEEEccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHHHHcccEEEEEccccccEEEccHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccEEEEEEEcccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccEEEEEEcccccEEEEEEEEccc
MMAGMATIGIGKGIEICTLFSCKIAVFGTIAGMLLTTIIPIILLIRQRNSLAKKVNETYSFLSEICDQLSKYHSlltenncltivwdgkdetpeIIGQLhqridipqtdtdLLSFENWLKFHHYIKLSKATEKLRKEGQSFDLVAETQNdcaikiegrvsgSCAFLRILSLDGIYSELAETTLKCKKLSNHISVFKVLFDSLDFLVWHRDQAGDILWANISykknteteGIVFQKAIGESRKLFKEEIKKRMISSSALEKNFCETVStlehgnnksYKIVRVLNSfgeagiaidvskeitvndqLTHTYEILHNLTVAIAIfdqnrylqfhNRSFVELWEIDLAFLATNPSNDELLEFLRSAnklpeqlnwkTWKENIFSVYKssethkdtwhlpngqtLHVIVTsnprggtiwMFENLTVQVDLETKYNTLVKVQGETIDHLsegvavfgpdgriklsnpafRSLWKteenrlspgthiRNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGTLELLSDSvleysiiplpnaqtmLTFVNVTDSVRAERALTEKNEALRKADEIKNSFVQHVSYelrspltniigFTDLLktsklgslnskqSQYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKvisdgklgsfVADRQRLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSvknngssipedmCKSVFNRFVsnahrgqrrgVGLGLSIVESFINLhgghvsisssdegvttincripske
MMAGMATIGIGKGIEICTLFSCKIAVFGTIAGMLLTTIIPIILLIRQRNSLAKKVNETYSFLSEICDQLSKYHSLLTENNCLTIVWDGKDETPEIIGQLhqridipqTDTDLLSFENWLKFHHYIKLSKATEKLRKEGQSFDLVAETQNDCAIKIEGRVSGSCAFLRILSLDGIYSELAETTLKCKKLSNHISVFKVLFDSLDFLVWHRDQAGDILWANISYKKNTETEGIVFQKAIGESRKLFKEEIKKRmisssalekNFCETVstlehgnnksYKIVRVLNSFGEAGIAIDVSKEITVNDQLTHTYEILHNLTVAIAIFDQNRYLQFHNRSFVELWEIDLAFLATNPSNDELLEFLRSANKlpeqlnwkTWKENIFSVYKSSEThkdtwhlpngqTLHVIVTSNPRGGTIWMFENLTVQVDLETKYNTLVKVQGETIDHLSEGvavfgpdgriklsnpAFRSLWkteenrlspgthiRNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGTLELLSDSVLEYSIIPLPNAQTMLTFVNVTDSVRAERALTeknealrkadeIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNSKQSQYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIAtkmhenniriKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRGVGLGLSIVESFINLHGghvsisssdegvttincripske
MMAGMATIGIGKGIEICTLFSCKIAVFGTIAGMllttiipiilliRQRNSLAKKVNETYSFLSEICDQLSKYHSLLTENNCLTIVWDGKDETPEIIGQLHQRIDIPQTDTDLLSFENWLKFHHYIKLSKATEKLRKEGQSFDLVAETQNDCAIKIEGRVSGSCAFLRILSLDGIYSELAETTLKCKKLSNHISVFKVLFDSLDFLVWHRDQAGDILWANISYKKNTETEGIVFQKAIGESRKLFKEEIKKRMISSSALEKNFCETVSTLEHGNNKSYKIVRVLNSFGEAGIAIDVSKEITVNDQLTHTYEILHNLTVAIAIFDQNRYLQFHNRSFVELWEIDLAFLATNPSNDELLEFLRSANKLPEQLNWKTWKENIFSVYKSSETHKDTWHLPNGQTLHVIVTSNPRGGTIWMFENLTVQVDLETKYNTLVKVQGETIDHLSEGVAVFGPDGRIKLSNPAFRSLWKTEENRLSPGTHIRNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGTLELLSDSVLEYSIIPLPNAQTMLTFVNVTDSVRAERALTEKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNSKQSQYVEYISASSTillnlvndildlATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIPSKE
*********I**GIEICTLFSCKIAVFGTIAGMLLTTIIPIILLIRQRNSLAK*V************QLSKYHSLLTENNCLTIVWDGKDETPEIIGQLHQRIDIPQTDTDLLSFENWLKFHHYIKLSKATEKLRKEGQSFDLVAETQNDCAIKIEGRVSGSCAFLRILSLDGIYS*****************VFKVLFDSLDFLVWHRDQAGDILWANISYKKNTETEGIVFQKAIGESRKLFKEEIKKRMISSSALEKNFCETVSTLEHGNNKSYKIVRVLNSFGEAGIAIDVSKEITVNDQLTHTYEILHNLTVAIAIFDQNRYLQFHNRSFVELWEIDLAFLATNPSNDELLEFLRSANKLPEQLNWKTWKENIFSVYKSSETHKDTWHLPNGQTLHVIVTSNPRGGTIWMFENLTVQVDLETKYNTLVKVQGETIDHLSEGVAVFGPDGRIKLSNPAFRSLWKTEENRLSPGTHIRNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGTLELLSDSVLEYSIIPLPNAQTMLTFVNVTDSVRAERALTEKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKL**L*SKQSQYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFN***************LGLSIVESFINLHGGHVSISSSDEGVTTINCRIPSKE
MMAGMATIGIGKGIEICTLFSCKIAVFGTIAGMLLTTIIPIILLIRQRNSLAKKVNETYSFLSEICDQLSKYHSLLTENNCLTIVWDGKDETPEIIGQLHQRIDIPQTDTDLLSFENWLKFHHYIKLSKATEKLRKEGQSFDLVAETQNDCAIKIEGRVSGSCAFLRILSLDGIYSELAETTLKCKKLSNHISVFKVLFDSLDFLVWHRDQAGDILWANISYKKNTETEGIVFQKAIGESRKLFKEEIKKRMISSSALEKNFCETVSTLEHGNNKSYKIVRVLNSFGEAGIAIDVSKEITVNDQLTHTYEILHNLTVAIAIFDQNRYLQFHNRSFVELWEIDLAFLATNPSNDELLEFLRSANKLPEQLNWKTWKENIFSVYKSSETHKDTWHLPNGQTLHVIVTSNPRGGTIWMFENLTVQVDLETKYNTLVKVQGETIDHLSEGVAVFGPDGRIKLSNPAFRSLWKTEENRLSPGTHIRNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGTLELLSDSVLEYSIIPLPNAQTMLTFVNVTDSVRAERALTEKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNSKQSQYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIPSKE
*******IGIGKGIEICTLFSCKIAVFGTIAGMLLTTIIPIILLIRQRNSLAKKVNETYSFLSEICDQLSKYHSLLTENNCLTIVWDGKDETPEIIGQLHQRIDIPQTDTDLLSFENWLKFHHYIKLSKATEKLRKEGQSFDLVAETQNDCAIKIEGRVSGSCAFLRILSLDGIYSELAETTLKCKKLSNHISVFKVLFDSLDFLVWHRDQAGDILWANISYKKNTETEGIVFQKAIGESRKLFKEEIKKRMISSSALEKNFCETVSTLEHGNNKSYKIVRVLNSFGEAGIAIDVSKEITVNDQLTHTYEILHNLTVAIAIFDQNRYLQFHNRSFVELWEIDLAFLATNPSNDELLEFLRSANKLPEQLNWKTWKENIFSVYKSSETHKDTWHLPNGQTLHVIVTSNPRGGTIWMFENLTVQVDLETKYNTLVKVQGETIDHLSEGVAVFGPDGRIKLSNPAFRSLWKTEENRLSPGTHIRNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGTLELLSDSVLEYSIIPLPNAQTMLTFVNVTDSVRAERALTEKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNSKQSQYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIPSKE
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
hhhhhhhhhhhhhhhhhhhhxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMAGMATIGIGKGIEICTLFSCKIAVFGTIAGMLLTTIIPIILLIRQRNSLAKKVNETYSFLSEICDQLSKYHSLLTENNCLTIVWDGKDETPEIIGQLHQRIDIPQTDTDLLSFENWLKFHHYIKLSKATEKLRKEGQSFDLVAETQNDCAIKIEGRVSGSCAFLRILSLDGIYSELAETTLKCKKLSNHISVFKVLFDSLDFLVWHRDQAGDILWANISYKKNTETEGIVFQKAIGESRKLFKEEIKKRMISSSALEKNFCETVSTLEHGNNKSYKIVRVLNSFGEAGIAIDVSKEITVNDQLTHTYEILHNLTVAIAIFDQNRYLQFHNRSFVELWEIDLAFLATNPSNDELLEFLRSANKLPEQLNWKTWKENIFSVYKSSETHKDTWHLPNGQTLHVIVTSNPRGGTIWMFENLTVQVDLETKYNTLVKVQGETIDHLSEGVAVFGPDGRIKLSNPAFRSLWKTEENRLSPGTHIRNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGTLELLSDSVLEYSIIPLPNAQTMLTFVNVTDSVRxxxxxxxxxxxxxxxxxxxxxFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNSKQSQYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIPSKE
MMAGMATIGIGKGIEICTLFSCKIAVFGTIAGMLLTTIIPIILLIRQRNSLAKKVNETYSFLSEICDQLSKYHSLLTENNCLTIVWDGKDETPEIIGQLHQRIDIPQTDTDLLSFENWLKFHHYIKLSKATEKLRKEGQSFDLVAETQNDCAIKIEGRVSGSCAFLRILSLDGIYSELAETTLKCKKLSNHISVFKVLFDSLDFLVWHRDQAGDILWANISYKKNTETEGIVFQKAIGESRKLFKEEIKKRMISSSALEKNFCETVSTLEHGNNKSYKIVRVLNSFGEAGIAIDVSKEITVNDQLTHTYEILHNLTVAIAIFDQNRYLQFHNRSFVELWEIDLAFLATNPSNDELLEFLRSANKLPEQLNWKTWKENIFSVYKSSETHKDTWHLPNGQTLHVIVTSNPRGGTIWMFENLTVQVDLETKYNTLVKVQGETIDHLSEGVAVFGPDGRIKLSNPAFRSLWKTEENRLSPGTHIRNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGTLELLSDSVLEYSIIPLPNAQTMLTFVNVTDSVRAERALTEKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNSKQSQYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIPSKE
MMAGMATIGIGKGIEICTLFSCKIAVFGTIAGMLLTTIIPIILLIRQRNSLAKKVNETYSFLSEICDQLSKYHSLLTENNCLTIVWDGKDETPEIIGQLHQRIDIPQTDTDLLSFENWLKFHHYIKLSKATEKLRKEGQSFDLVAETQNDCAIKIEGRVSGSCAFLRILSLDGIYSELAETTLKCKKLSNHISVFKVLFDSLDFLVWHRDQAGDILWANISYKKNTETEGIVFQKAIGESRKLFKEEIKKRMISSSALEKNFCETVSTLEHGNNKSYKIVRVLNSFGEAGIAIDVSKEITVNDQLTHTYEILHNLTVAIAIFDQNRYLQFHNRSFVELWEIDLAFLATNPSNDELLEFLRSANKLPEQLNWKTWKENIFSVYKSSETHKDTWHLPNGQTLHVIVTSNPRGGTIWMFENLTVQVDLETKYNTLVKVQGETIDHLSEGVAVFGPDGRIKLSNPAFRSLWKTEENRLSPGTHIRNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGTLELLSDSVLEYSIIPLPNAQTMLTFVNVTDSVRAERALTEKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNSKQSQYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIPSKE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target792 two-component sensor histidine kinase protein [Candidat
254780701495 putative two-component sensor histidine kinase tra 1e-28
254780413820 PAS/PAC sensor signal transduction histidine kinas 1e-26
254780903766 two-component sensor histidine kinase protein [Can 1e-24
254780450 803 two-component sensor histidine kinase/response reg 0.005
>gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 495 Back     alignment
 Score =  119 bits (299), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 133/242 (54%), Gaps = 10/242 (4%)

Query: 552 ERALTEKNEALRKADE---IKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNSKQ-S 607
           E A +  +E  ++A+E    K+ F+  +S+ELR+PL  I+GF+++++   +G LN++   
Sbjct: 229 EVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNETYK 288

Query: 608 QYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNI 667
           +Y+  I  S   LLNL+N+ILDL+ ++AG  +L+ S I L D++ E    +  +  E NI
Sbjct: 289 EYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNI 348

Query: 668 RIKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAA--RDNGDFIFSVKN 725
            I    D  L S  AD + + Q+   +LSNA+ F++ G  V +        G +I S+K+
Sbjct: 349 EIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQYI-SIKD 407

Query: 726 NGSSIPEDMCKSVFNRF--VSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSS-DEGVT 782
           NG  I E    +V   F   S A +   +GVGLGL I +S +  HGG   I S   EGV 
Sbjct: 408 NGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLREGVE 467

Query: 783 TI 784
            I
Sbjct: 468 VI 469

>gi|254780413|ref|YP_003064826.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Back     alignment
 Score =  113 bits (282), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 94/357 (26%), Positives = 174/357 (48%), Gaps = 20/357 (5%)

Query: 444 SEGVAVFGPDGRIKLSNPAFRSL--WKTEENRLSPGTHI--RNIAATCSRYYNESDGWDL 499
           S+G+A+   +G I  +N A   L  +  E+    P T    +N  +  + Y  E    DL
Sbjct: 462 SDGIAIINREGIILSTNRAVSKLFGYPVEDILRKPFTVFLEQNTPSVMNHYLTEILSLDL 521

Query: 500 FAAIITSFDDERKSLQGTLE--LLSDSVLEYSIIPLPNAQTM-LTFVNVTDSVRAERALT 556
              +      E+ +L  T E  LLS  ++   I  LP +    LT  ++++  + +  L+
Sbjct: 522 RQTL------EKITLGSTKEEKLLSLRII---IKKLPFSSCYSLTMHDISEWKQEKNKLS 572

Query: 557 EKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSL-NSKQSQYVEYISA 615
              +   K    K+ F+  VS+E+R+PLT IIGF++++K  + G L N +  +Y  YI  
Sbjct: 573 HAKKIAEKESSHKSDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDR 632

Query: 616 SSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDG 675
           S  ++L++VND+LD++ +++G M L++  + L++ ++E    +    +E  I I+     
Sbjct: 633 SGNLVLDIVNDLLDISKIESGKMNLHFEPVSLDEAVSEAISLVQLYANEKRILIRTSFAN 692

Query: 676 KLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAAR-DNGDFIFSVKNNGSSIPEDM 734
            +   +AD + + QI   ILSNA+ F+  G  +I+      N + I  V++ G  +    
Sbjct: 693 NIPRILADLRSVKQIALNILSNAIHFTPSGGQIIISTTHTSNEEVILRVRDTGVGMTNYE 752

Query: 735 CKSVFNRF--VSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIP 789
            +     F  + N+ + +  G GLGL + ++ ++ + G   I S+    T I    P
Sbjct: 753 LEKAMKPFGQIPNSQQIRGEGTGLGLPLAKAMVDANMGKFYIFSTPAKGTLIEIIFP 809

>gi|254780903|ref|YP_003065316.1| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 766 Back     alignment
 Score =  106 bits (265), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 148/286 (51%), Gaps = 21/286 (7%)

Query: 509 DERKSLQGTLELLSDS--VLEYSIIPLPNAQTMLTFVNVTDSVRAERALTEKNEALRKAD 566
           + ++ L+ T+  LS S  +LE         +T L+  N    V  ERA T        A+
Sbjct: 496 ESKRRLKATINDLSTSRQILE-------RQKTELSIANAKYQVEKERAET--------AN 540

Query: 567 EIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNS-KQSQYVEYISASSTILLNLVN 625
           + K+ F+  +S+ELR+PL  I+GF++++K    G L S K  +Y + I  S   LLN++N
Sbjct: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600

Query: 626 DILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDGKLGSFVADRQ 685
           +IL+++ ++   + ++     L  ++NE  + I +     NI+I+     +L  F AD++
Sbjct: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKR 659

Query: 686 RLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFNRF--V 743
            + +I   ILSN++ F++    ++++ ++     I ++ + G  IP+   + +   F  +
Sbjct: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719

Query: 744 SNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIP 789
            N +     G GLGL+I ++  NLHGG + I S +   T +   +P
Sbjct: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765

>gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Back     alignment
 Score = 34.7 bits (78), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 720 IFSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDE 779
           +  V++ G  +  D+ + +F  F +    G+  G GLGLS+V   I   GG++ +  S+ 
Sbjct: 583 LVEVEDTGIGMSPDIMEKIFEPFFTTKKVGE--GTGLGLSVVYGIIRQSGGYI-LPESEV 639

Query: 780 GVTTI 784
           G  TI
Sbjct: 640 GKGTI 644

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target792 two-component sensor histidine kinase protein [Candidat
315122049792 two-component sensor histidine kinase protein [Candidat 1 0.0
222084231824 two-component sensor histidine kinase protein [Agrobact 1 0.0
190889670861 two-component sensor histidine kinase [Rhizobium etli C 1 0.0
327192798861 putative two-component sensor histidine kinase protein 1 0.0
86355698860 two-component sensor histidine kinase protein [Rhizobiu 1 0.0
222147058911 two component sensor kinase [Agrobacterium vitis S4] Le 1 0.0
209551534861 PAS/PAC sensor signal transduction histidine kinase [Rh 1 0.0
241206973861 PAS/PAC sensor signal transduction histidine kinase [Rh 1 0.0
15887386881 two component sensor kinase [Agrobacterium tumefaciens 1 0.0
116249796861 two-component sensor histidine kinase transcriptional r 1 0.0
>gi|315122049|ref|YP_004062538.1| two-component sensor histidine kinase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 792 Back     alignment and organism information
 Score = 1305 bits (3376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/792 (78%), Positives = 709/792 (89%), Gaps = 2/792 (0%)

Query: 1   MMAGMATIGIGKGIEICTLFSCKIAVFGTIAGMLLTTIIPIILLIRQRNSLAKKVNETYS 60
           M  G+ATI IG  + I  +FSCK+ +FGTI GMLL TIIP+I+LI+QRN+LAK+VNE+YS
Sbjct: 1   MTTGIATIDIGNEMGIWAIFSCKMLIFGTIVGMLLATIIPLIMLIKQRNNLAKQVNESYS 60

Query: 61  FLSEICDQLSKYHSLLTENNCLTIVWDGKDETPEIIGQLHQRIDIPQTDTDLLSFENWLK 120
             SEIC QLSKYH+LLTENNCL IVWDGKD TPEIIGQL++R+DIP  DTD LSFENWLK
Sbjct: 61  SFSEICYQLSKYHALLTENNCLIIVWDGKDGTPEIIGQLNRRMDIPLKDTDFLSFENWLK 120

Query: 121 FHHYIKLSKATEKLRKEGQSFDLVAETQNDCAIKIEGRVSGSCAFLRILSLDGIYSELAE 180
           FHHYI+LSK  +KLR+EGQSFDL+AET+ND AIKIEGRVSGSCAFLR L+L+G+YSELAE
Sbjct: 121 FHHYIQLSKEIKKLREEGQSFDLIAETKNDWAIKIEGRVSGSCAFLRFLTLNGVYSELAE 180

Query: 181 TTLKCKKLSNHISVFKVLFDSLDFLVWHRDQAGDILWANISYKKNTETEGIVFQKAIGES 240
           TTL+CKK+S H+SVFK+LFDSLDFLVW R+Q G++LWAN SYKKNTE      QK I ++
Sbjct: 181 TTLECKKISGHMSVFKLLFDSLDFLVWQRNQRGELLWANNSYKKNTEETSP--QKEIFDN 238

Query: 241 RKLFKEEIKKRMISSSALEKNFCETVSTLEHGNNKSYKIVRVLNSFGEAGIAIDVSKEIT 300
            KLF+EE+KKRMISS  LE+NFC+TVS++E G +KSYKI++VLNSFGEAGIAIDVSKEIT
Sbjct: 239 YKLFEEEVKKRMISSVELEENFCKTVSSIERGKHKSYKIIKVLNSFGEAGIAIDVSKEIT 298

Query: 301 VNDQLTHTYEILHNLTVAIAIFDQNRYLQFHNRSFVELWEIDLAFLATNPSNDELLEFLR 360
            NDQLTHTY+IL NLTVAIAIFDQNRYLQF+N+SF+ LW++D AFL +NPSNDE LEFLR
Sbjct: 299 ANDQLTHTYDILQNLTVAIAIFDQNRYLQFYNQSFMALWQMDPAFLKSNPSNDEFLEFLR 358

Query: 361 SANKLPEQLNWKTWKENIFSVYKSSETHKDTWHLPNGQTLHVIVTSNPRGGTIWMFENLT 420
           SANKLPEQL+WKTWKE IFS YKSS  HKDTWHLP GQTLHVIV +NP GGTIWMFENLT
Sbjct: 359 SANKLPEQLDWKTWKEKIFSAYKSSGDHKDTWHLPTGQTLHVIVVTNPLGGTIWMFENLT 418

Query: 421 VQVDLETKYNTLVKVQGETIDHLSEGVAVFGPDGRIKLSNPAFRSLWKTEENRLSPGTHI 480
           VQVDLET+YNTLVKVQGE IDHLSEGVAVFGPDGRI+LSNP FRSLWK EE ++SPGTHI
Sbjct: 419 VQVDLETRYNTLVKVQGEAIDHLSEGVAVFGPDGRIQLSNPVFRSLWKVEEEQVSPGTHI 478

Query: 481 RNIAATCSRYYNESDGWDLFAAIITSFDDERKSLQGTLELLSDSVLEYSIIPLPNAQTML 540
           RNIA+TCS+YYN+SDGWDLFAAIITSF+DERKSLQGTLELLSD+VLEYS+IPLPNAQTML
Sbjct: 479 RNIASTCSKYYNKSDGWDLFAAIITSFEDERKSLQGTLELLSDAVLEYSVIPLPNAQTML 538

Query: 541 TFVNVTDSVRAERALTEKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLG 600
           TFVNVTDSVRAERALTEKNEAL KADEIKN+FVQHVSYELRSPLTNIIGFTDLLKTSKLG
Sbjct: 539 TFVNVTDSVRAERALTEKNEALHKADEIKNNFVQHVSYELRSPLTNIIGFTDLLKTSKLG 598

Query: 601 SLNSKQSQYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIAT 660
            LN KQSQYVEYIS SS +LLNLVNDILDLATV+AGIMKLNYS I+L+DLLNEVKQSIA+
Sbjct: 599 GLNPKQSQYVEYISTSSELLLNLVNDILDLATVNAGIMKLNYSEIILSDLLNEVKQSIAS 658

Query: 661 KMHENNIRIKVISDGKLGSFVADRQRLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFI 720
           KMHENNI ++++S   LGS VADRQRLLQIF+KILSNA DFSSKGSTV+L+A RD  DF+
Sbjct: 659 KMHENNITLEIVSRKALGSVVADRQRLLQIFAKILSNAADFSSKGSTVLLEADRDATDFV 718

Query: 721 FSVKNNGSSIPEDMCKSVFNRFVSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEG 780
           FSV +NGS+IPEDM ++VFN FVS++H GQRRG+GLGLSIV+SF+NLHGG V ISS  EG
Sbjct: 719 FSVTSNGSNIPEDMRQNVFNGFVSDSHHGQRRGMGLGLSIVKSFLNLHGGSVFISSPHEG 778

Query: 781 VTTINCRIPSKE 792
            T  NCRIPSK+
Sbjct: 779 TTIFNCRIPSKK 790


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084231|ref|YP_002542757.1| two-component sensor histidine kinase protein [Agrobacterium radiobacter K84] Length = 824 Back     alignment and organism information
>gi|190889670|ref|YP_001976212.1| two-component sensor histidine kinase [Rhizobium etli CIAT 652] Length = 861 Back     alignment and organism information
>gi|327192798|gb|EGE59726.1| putative two-component sensor histidine kinase protein [Rhizobium etli CNPAF512] Length = 861 Back     alignment and organism information
>gi|86355698|ref|YP_467590.1| two-component sensor histidine kinase protein [Rhizobium etli CFN 42] Length = 860 Back     alignment and organism information
>gi|222147058|ref|YP_002548015.1| two component sensor kinase [Agrobacterium vitis S4] Length = 911 Back     alignment and organism information
>gi|209551534|ref|YP_002283451.1| PAS/PAC sensor signal transduction histidine kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 861 Back     alignment and organism information
>gi|241206973|ref|YP_002978069.1| PAS/PAC sensor signal transduction histidine kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 861 Back     alignment and organism information
>gi|15887386|ref|NP_353067.1| two component sensor kinase [Agrobacterium tumefaciens str. C58] Length = 881 Back     alignment and organism information
>gi|116249796|ref|YP_765634.1| two-component sensor histidine kinase transcriptional regulatory protein [Rhizobium leguminosarum bv. viciae 3841] Length = 861 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target792 two-component sensor histidine kinase protein [Candidat
COG0642336 COG0642, BaeS, Signal transduction histidine kinase [Si 2e-31
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS 1e-26
TIGR01386457 TIGR01386, cztS_silS_copS, heavy metal sensor kinase 2e-22
PRK15347 921 PRK15347, PRK15347, two component system sensor kinase 2e-22
PRK11091 779 PRK11091, PRK11091, aerobic respiration control sensor 5e-22
PRK11466 914 PRK11466, PRK11466, hybrid sensory histidine kinase Tor 1e-21
PRK11100475 PRK11100, PRK11100, sensory histidine kinase CreC; Prov 2e-21
PRK10841 924 PRK10841, PRK10841, hybrid sensory kinase in two-compon 9e-21
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinase Bar 8e-20
COG4251750 COG4251, COG4251, Bacteriophytochrome (light-regulated 1e-19
PRK10490895 PRK10490, PRK10490, sensor protein KdpD; Provisional 1e-17
PRK09959 1197 PRK09959, PRK09959, hybrid sensory histidine kinase in 2e-16
PRK10549466 PRK10549, PRK10549, signal transduction histidine-prote 1e-12
PRK09835482 PRK09835, PRK09835, sensor kinase CusS; Provisional 5e-12
TIGR03785703 TIGR03785, marine_sort_HK, proteobacterial dedicated so 8e-12
COG4191603 COG4191, COG4191, Signal transduction histidine kinase 2e-11
PRK10364457 PRK10364, PRK10364, sensor protein ZraS; Provisional 2e-11
PRK10604433 PRK10604, PRK10604, sensor protein RstB; Provisional 2e-10
PRK09303380 PRK09303, PRK09303, adaptive-response sensory kinase; V 1e-07
PRK09470461 PRK09470, cpxA, two-component sensor protein; Provision 3e-07
PRK09467435 PRK09467, envZ, osmolarity sensor protein; Provisional 3e-06
COG2205890 COG2205, KdpD, Osmosensitive K+ channel histidine kinas 2e-32
TIGR02966333 TIGR02966, phoR_proteo, phosphate regulon sensor kinase 7e-28
PRK11360607 PRK11360, PRK11360, sensory histidine kinase AtoS; Prov 1e-18
COG5000712 COG5000, NtrY, Signal transduction histidine kinase inv 2e-14
COG3852363 COG3852, NtrB, Signal transduction histidine kinase, ni 4e-14
COG5002459 COG5002, VicK, Signal transduction histidine kinase [Si 7e-21
PRK11006430 PRK11006, phoR, phosphate regulon sensor protein; Provi 2e-10
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPases 3e-20
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, 2e-19
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; This 4e-16
PRK10755356 PRK10755, PRK10755, sensor protein BasS/PmrB; Provision 8e-07
pfam0051266 pfam00512, HisKA, His Kinase A (phosphoacceptor) domain 7e-11
smart0038866 smart00388, HisKA, His Kinase A (phosphoacceptor) domai 1e-10
cd0008265 cd00082, HisKA, Histidine Kinase A (dimerization/phosph 4e-09
KOG0519 786 KOG0519, KOG0519, KOG0519, Sensory transduction histidi 2e-06
COG3290537 COG3290, CitA, Signal transduction histidine kinase reg 9e-06
PRK13837 828 PRK13837, PRK13837, two-component VirA-like sensor kina 8e-05
TIGR02938494 TIGR02938, nifL_nitrog, nitrogen fixation negative regu 1e-05
PRK10337449 PRK10337, PRK10337, sensor protein QseC; Provisional 1e-05
PRK13557 540 PRK13557, PRK13557, histidine kinase; Provisional 3e-04
PRK11073348 PRK11073, glnL, nitrogen regulation protein NR(II); Pro 3e-04
TIGR02916679 TIGR02916, PEP_his_kin, putative PEP-CTERM system histi 7e-04
>gnl|CDD|30987 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163083 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|162333 TIGR01386, cztS_silS_copS, heavy metal sensor kinase Back     alignment and domain information
>gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|182956 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|183148 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>gnl|CDD|182962 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|182968 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|33974 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182496 PRK10490, PRK10490, sensor protein KdpD; Provisional Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|182539 PRK10549, PRK10549, signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional Back     alignment and domain information
>gnl|CDD|163497 TIGR03785, marine_sort_HK, proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>gnl|CDD|33926 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182411 PRK10364, PRK10364, sensor protein ZraS; Provisional Back     alignment and domain information
>gnl|CDD|182583 PRK10604, PRK10604, sensor protein RstB; Provisional Back     alignment and domain information
>gnl|CDD|181772 PRK09303, PRK09303, adaptive-response sensory kinase; Validated Back     alignment and domain information
>gnl|CDD|181885 PRK09470, cpxA, two-component sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|181882 PRK09467, envZ, osmolarity sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|32387 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163090 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR Back     alignment and domain information
>gnl|CDD|183098 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>gnl|CDD|34605 COG5000, NtrY, Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33642 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|34607 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|128669 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|145582 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|28956 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|182702 PRK10755, PRK10755, sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>gnl|CDD|144196 pfam00512, HisKA, His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>gnl|CDD|128670 smart00388, HisKA, His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33099 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|184354 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL Back     alignment and domain information
>gnl|CDD|182388 PRK10337, PRK10337, sensor protein QseC; Provisional Back     alignment and domain information
>gnl|CDD|184141 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|182947 PRK11073, glnL, nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>gnl|CDD|163071 TIGR02916, PEP_his_kin, putative PEP-CTERM system histidine kinase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 792 two-component sensor histidine kinase protein [Candidat
PRK11091 779 aerobic respiration control sensor protein ArcB; Provis 100.0
PRK10841 947 hybrid sensory kinase in two-component regulatory syste 100.0
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 100.0
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 100.0
PRK13557 538 histidine kinase; Provisional 100.0
PRK11006431 phoR phosphate regulon sensor protein; Provisional 100.0
PRK11360607 sensory histidine kinase AtoS; Provisional 100.0
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 100.0
COG5002459 VicK Signal transduction histidine kinase [Signal trans 100.0
PRK11086541 sensory histidine kinase DcuS; Provisional 100.0
COG3852363 NtrB Signal transduction histidine kinase, nitrogen spe 100.0
COG5000712 NtrY Signal transduction histidine kinase involved in n 100.0
COG3290537 CitA Signal transduction histidine kinase regulating ci 100.0
PRK10618 881 phosphotransfer intermediate protein in two-component r 99.93
PRK13559363 hypothetical protein; Provisional 99.89
TIGR02956 1052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 100.0
PRK11466 912 hybrid sensory histidine kinase TorS; Provisional 100.0
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 100.0
PRK10490895 sensor protein KdpD; Provisional 100.0
PRK10364455 sensor protein ZraS; Provisional 100.0
PRK13837 831 two-component VirA-like sensor kinase; Provisional 100.0
PRK11100475 sensory histidine kinase CreC; Provisional 100.0
PRK10549467 signal transduction histidine-protein kinase BaeS; Prov 100.0
PRK09835482 sensor kinase CusS; Provisional 100.0
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Signal 100.0
PRK10337446 sensor protein QseC; Provisional 100.0
PRK09470461 cpxA two-component sensor protein; Provisional 100.0
PRK10604433 sensor protein RstB; Provisional 100.0
PRK10755355 sensor protein BasS/PmrB; Provisional 100.0
PRK09467437 envZ osmolarity sensor protein; Provisional 100.0
PRK10815484 sensor protein PhoQ; Provisional 100.0
TIGR01386483 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR 100.0
COG4191603 Signal transduction histidine kinase regulating C4-dica 100.0
COG4251750 Bacteriophytochrome (light-regulated signal transductio 100.0
COG0642336 BaeS Signal transduction histidine kinase [Signal trans 100.0
TIGR02916696 PEP_his_kin putative PEP-CTERM system histidine kinase; 100.0
COG4192673 Signal transduction histidine kinase regulating phospho 100.0
KOG0519 786 consensus 99.88
PRK10935568 nitrate/nitrite sensor protein NarQ; Provisional 99.83
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 99.72
PRK11644497 sensory histidine kinase UhpB; Provisional 99.69
COG4585365 Signal transduction histidine kinase [Signal transducti 99.69
COG3920221 Signal transduction histidine kinase [Signal transducti 99.64
COG2972456 Predicted signal transduction protein with a C-terminal 99.6
COG3850574 NarQ Signal transduction histidine kinase, nitrate/nitr 99.56
COG3275557 LytS Putative regulator of cell autolysis [Signal trans 99.5
COG3851497 UhpB Signal transduction histidine kinase, glucose-6-ph 99.34
COG4564459 Signal transduction histidine kinase [Signal transducti 99.21
KOG0519 786 consensus 97.89
COG5385214 Uncharacterized protein conserved in bacteria [Function 97.89
pfam10090181 DUF2328 Uncharacterized protein conserved in bacteria ( 97.79
PRK13560807 hypothetical protein; Provisional 100.0
PRK09303378 adaptive-response sensory kinase; Validated 100.0
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 100.0
PRK09776 1116 putative sensor protein; Provisional 100.0
PRK13560807 hypothetical protein; Provisional 100.0
PRK097761116 putative sensor protein; Provisional 99.97
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine kina 99.96
pfam02518111 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-l 99.96
cd00075103 HATPase_c Histidine kinase-like ATPases; This family in 99.94
PRK03660146 anti-sigma F factor; Provisional 99.57
PRK04069158 serine-protein kinase RsbW; Provisional 98.83
TIGR01925137 spIIAB anti-sigma F factor; InterPro: IPR010194 This en 98.61
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein kina 98.48
TIGR01924161 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 Th 97.0
COG5381184 Uncharacterized protein conserved in bacteria [Function 93.52
PRK11359799 cAMP phosphodiesterase; Provisional 99.93
PRK11359 799 cAMP phosphodiesterase; Provisional 99.89
PRK10060663 RNase II stability modulator; Provisional 99.06
PRK10547 662 chemotaxis protein CheA; Provisional 99.86
COG0643 716 CheA Chemotaxis protein histidine kinase and related ki 99.84
KOG0787414 consensus 99.08
PRK11091779 aerobic respiration control sensor protein ArcB; Provis 99.7
PRK13557538 histidine kinase; Provisional 99.58
PRK11006431 phoR phosphate regulon sensor protein; Provisional 99.09
PRK099591197 hybrid sensory histidine kinase in two-component regula 99.01
PRK13559363 hypothetical protein; Provisional 98.96
PRK13558674 bacterio-opsin activator; Provisional 98.94
pfam00989112 PAS PAS fold. The PAS fold corresponds to the structura 98.85
TIGR00229130 sensory_box PAS domain S-box; InterPro: IPR000014 PAS d 98.67
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 98.62
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 98.02
PRK10841947 hybrid sensory kinase in two-component regulatory syste 97.85
COG5002459 VicK Signal transduction histidine kinase [Signal trans 97.69
COG3852363 NtrB Signal transduction histidine kinase, nitrogen spe 96.53
COG3290537 CitA Signal transduction histidine kinase regulating ci 95.56
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 95.25
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 99.69
pfam0051266 HisKA His Kinase A (phosphoacceptor) domain. dimerizati 99.41
smart0038866 HisKA His Kinase A (phosphoacceptor) domain. Dimerisati 99.23
cd0008265 HisKA Histidine Kinase A (dimerization/phosphoacceptor) 99.05
PRK10060663 RNase II stability modulator; Provisional 99.19
pfam08448110 PAS_4 PAS fold. The PAS fold corresponds to the structu 99.1
PRK13558674 bacterio-opsin activator; Provisional 98.93
PRK11360607 sensory histidine kinase AtoS; Provisional 98.88
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 98.58
COG5000712 NtrY Signal transduction histidine kinase involved in n 97.95
PRK11086541 sensory histidine kinase DcuS; Provisional 97.33
TIGR02040453 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR 98.81
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 98.74
TIGR01059818 gyrB DNA gyrase, B subunit; InterPro: IPR011557 DNA top 93.71
pfam08448110 PAS_4 PAS fold. The PAS fold corresponds to the structu 98.73
smart0009167 PAS PAS domain. PAS motifs appear in archaea, eubacteri 97.29
cd00130103 PAS PAS domain; PAS motifs appear in archaea, eubacteri 97.23
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mechanism 97.16
PTZ00108 1506 DNA topoisomerase II; Provisional 94.13
pfam00989112 PAS PAS fold. The PAS fold corresponds to the structura 98.69
TIGR00229130 sensory_box PAS domain S-box; InterPro: IPR000014 PAS d 98.41
pfam0844790 PAS_3 PAS fold. The PAS fold corresponds to the structu 96.11
COG1389538 DNA topoisomerase VI, subunit B [DNA replication, recom 98.67
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 97.57
cd00130103 PAS PAS domain; PAS motifs appear in archaea, eubacteri 96.94
PRK04184533 DNA topoisomerase VI subunit B; Validated 98.6
TIGR01052662 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005 98.53
PRK00095612 mutL DNA mismatch repair protein; Reviewed 98.32
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 96.12
PTZ00130824 heat shock protein 90; Provisional 94.31
PRK13719220 conjugal transfer transcriptional regulator TraJ; Provi 93.47
KOG1978672 consensus 90.89
KOG1229775 consensus 90.11
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 98.31
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 96.98
TIGR02040453 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR 98.08
TIGR00585367 mutl DNA mismatch repair protein MutL; InterPro: IPR014 97.86
smart00433594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomerase II, 95.95
PRK05559633 DNA topoisomerase IV subunit B; Reviewed 94.02
COG0187635 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topois 91.92
COG0323638 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA 97.36
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mechanism 96.98
smart0009167 PAS PAS domain. PAS motifs appear in archaea, eubacteri 96.96
PTZ00272701 heat shock protein 83 kDa (Hsp83); Provisional 96.75
PRK05218612 heat shock protein 90; Provisional 96.22
COG0326623 HtpG Molecular chaperone, HSP90 family [Posttranslation 95.58
PRK05644725 gyrB DNA gyrase subunit B; Validated 95.17
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 95.12
KOG3558768 consensus 93.95
KOG1979694 consensus 93.41
PTZ00109 941 DNA gyrase subunit b; Provisional 92.67
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR006290 Members of this family contain a sensor histidine kinase domain (IPR003661 from INTERPRO) and a domain found in bacterial signal proteins (IPR003660 from INTERPRO) Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase; InterPro: IPR014265 Proteins in this entry are putative periplasmic sensor signal transduction histidine kinases Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>COG5385 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam10090 DUF2328 Uncharacterized protein conserved in bacteria (DUF2328) Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>pfam02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor; InterPro: IPR010194 This entry describes the SpoIIAB anti-sigma F factor Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01924 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 This entry describes the anti-sigma B factor also known as serine-protein kinase RsbW Back     alignment and domain information
>COG5381 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11359 cAMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK11359 cAMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>KOG0787 consensus Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>pfam00989 PAS PAS fold Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box; InterPro: IPR000014 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>pfam00512 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>smart00388 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>pfam08448 PAS_4 PAS fold Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR011785 This entry represents the transcriptional regulator PpsR which is strictly associated with photosynthetic proteobacteria and found in photosynthetic operons Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit; InterPro: IPR011557 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>pfam08448 PAS_4 PAS fold Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00108 DNA topoisomerase II; Provisional Back     alignment and domain information
>pfam00989 PAS PAS fold Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box; InterPro: IPR000014 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain Back     alignment and domain information
>pfam08447 PAS_3 PAS fold Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005734 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional Back     alignment and domain information
>KOG1978 consensus Back     alignment and domain information
>KOG1229 consensus Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR011785 This entry represents the transcriptional regulator PpsR which is strictly associated with photosynthetic proteobacteria and found in photosynthetic operons Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL; InterPro: IPR014763 This entry represents DNA mismatch repair proteins, such as MutL Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>KOG3558 consensus Back     alignment and domain information
>KOG1979 consensus Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target792 two-component sensor histidine kinase protein [Candidat
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, selenom 2e-44
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase domain, A 5e-39
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bundle, c 4e-36
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kin 7e-32
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-bind 4e-22
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; 1e-20
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; 1e-19
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif r 3e-18
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, GHL AT 9e-06
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinase, ph 6e-43
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduction, 7e-24
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding domain, 3e-22
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, transf 6e-21
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein (ENVZ 7e-21
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine kina 4e-17
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, signaling 2e-09
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-sigma f 4e-04
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding prote 6e-04
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, 0.001
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPase, he 8e-09
1joy_A67 Protein (ENVZ_ecoli); histidine kinase, sensory transdu 4e-07
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain, sen 2e-06
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transductio 4e-04
1b3q_A 379 Protein (chemotaxis protein CHEA); histine kinase, sign 2e-05
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Length = 258 Back     alignment and structure
 Score =  176 bits (448), Expect = 2e-44
 Identities = 65/252 (25%), Positives = 120/252 (47%), Gaps = 14/252 (5%)

Query: 544 NVTDSVRAERALTEKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLN 603
           NVT+S   ER        L++ D +K  F+ ++S+ELR+PLT I  + + +  S      
Sbjct: 3   NVTESKELER--------LKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDL 54

Query: 604 SKQSQYVEYISASSTILLNLVNDILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMH 663
           S   +++E I   S  L NL+N++LD + ++   +++N   + L DL+     +I     
Sbjct: 55  STLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFAS 114

Query: 664 ENNIRIKVISDGKLGSFV-ADRQRLLQIFSKILSNAMDFSSKGSTVI---LKAARDNGDF 719
            +N+ +   S+         D  R+ Q+   +L+N + +S K +      +     +G  
Sbjct: 115 SHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGV 174

Query: 720 IFSVKNNGSSIPEDMCKSVFNRF--VSNAHRGQRRGVGLGLSIVESFINLHGGHVSISSS 777
           +  V++NG  IP+     +F +F  V ++   +  G GLGL+I +  + LHGG + + S 
Sbjct: 175 LIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESE 234

Query: 778 DEGVTTINCRIP 789
               +     IP
Sbjct: 235 VGKGSRFFVWIP 246


>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Length = 222 Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Length = 388 Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Length = 394 Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Length = 419 Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Length = 407 Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Length = 394 Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Length = 218 Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transferase, two-component regulatory system; 3.80A {Thermotoga maritima} Length = 349 Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Length = 152 Back     alignment and structure