255764499

255764499

1-acyl-sn-glycerol-3-phosphate acyltransferase

GeneID in NCBI database:8209577Locus tag:CLIBASIA_02335
Protein GI in NCBI database:255764499Protein Accession:YP_003064993.2
Gene range:-(701370, 702170)Protein Length:266aa
Gene description:1-acyl-sn-glycerol-3-phosphate acyltransferase
COG prediction:[I] 1-acyl-sn-glycerol-3-phosphate acyltransferase
KEGG prediction:plsC; 1-acyl-sn-glycerol-3-phosphate acyltransferase; K00655 1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
SEED prediction:1-acyl-sn-glycerol-3-phosphate acyltransferase
Pathway involved in KEGG:Glycerolipid metabolism [PATH:las00561]
Glycerophospholipid metabolism [PATH:las00564]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP4 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
MIMIFIRSLIFNIFFFIHIFIVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTTVQIEGVDNIPSTGCIIAIKHQSSWDTFYFLTCIQDPIFILKHTVFYIPIIGFYCFKQGMIGVKRNSKNLDMKSIINRAKKAVMDNRQLIIYPEGTRRSPGDMPIYKKGIAHIYESLSVPVIPIVVHAGLFWPRKKFMRYPGNFKVRVLKPIPAGIPRKIFFAELQEKMEHASNNLLLETIRDNPQLYIPASTKKALQHLRQIQNNS
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccEEEEEccccHHHHHHHHHHccccEEEEEHHHHccccHHHHHHHHccEEEccccccHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHccccEEEEEEEcccccccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccHHccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccEEEEcccccHHHHHHHHHHcccccEHHHHHHHHccHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHccccEEEEEEccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccc
MIMIFIRSLIFNIFFFIHIFIVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTtvqiegvdnipstGCIIAIKHQSSWDTFYFLTCIQDPIFILKHTVFYIPIIGFYCfkqgmigvkrnsknlDMKSIINRAKKAvmdnrqliiypegtrrspgdmpiyKKGIAHIyeslsvpvipivvhaglfwprkkfmrypgnfkvrvlkpipagiprKIFFAELQEKMEHASNNLLLetirdnpqlyipaSTKKALQHLRQIQNNS
MIMIFIRSLIFNIFFFIHIFIVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTTVQIEGVDNIPSTGCIIAIKHQSSWDTFYFLTCIQDPIFILKHTVFYIPIIGFYCFKQGMIGVKRNSKNLDMKSIINRakkavmdnrqliiypegtrrspgdMPIYKKGIAHIYESLSVPVIPIVVHAGLFWPRKKFMRYPGNfkvrvlkpipagIPRKIFFAELQEKMEHASNNLLLETIRDNPQLYIPASTKKALQHLRQIQNNS
MIMIFIRSLifnifffihifiVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTTVQIEGVDNIPSTGCIIAIKHQSSWDTFYFLTCIQDPIFILKHTVFYIPIIGFYCFKQGMIGVKRNSKNLDMKSIINRAKKAVMDNRQLIIYPEGTRRSPGDMPIYKKGIAHIYESLSVPVIPIVVHAGLFWPRKKFMRYPGNFKVRVLKPIPAGIPRKIFFAELQEKMEHASNNLLLETIRDNPQLYIPASTKKALQHLRQIQNNS
MIMIFIRSLIFNIFFFIHIFIVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTTVQIEGVDNIPSTGCIIAIKHQSSWDTFYFLTCIQDPIFILKHTVFYIPIIGFYCFKQGMIGVKRNSKNL***********AVMDNRQLIIYPEGTRRSPGDMPIYKKGIAHIYESLSVPVIPIVVHAGLFWPRKKFMRYPGNFKVRVLKPIPAGIPRKIFFAELQEKMEHASNN********************************
MIMIFIRSLIFNIFFFIHIFIVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTTVQIEGVDNIPSTGCIIAIKHQSSWDTFYFLTCIQDPIFILKHTVFYIPIIGFYCFKQGMIGVKRNSKNLDMKSIINRAKKAVMDNRQLIIYPEGTRRSPGDMPIYKKGIAHIYESLSVPVIPIVVHAGLFWPRKKFMRYPGNFKVRVLKPIPAGIPRKIFFAELQEKMEHASNNLLLETIRDNPQLYIPASTKKALQHLRQIQNNS
MIMIFIRSLIFNIFFFIHIFIVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTTVQIEGVDNIPSTGCIIAIKHQSSWDTFYFLTCIQDPIFILKHTVFYIPIIGFYCFKQGMIGVKRNSKNLDMKSIINRAKKAVMDNRQLIIYPEGTRRSPGDMPIYKKGIAHIYESLSVPVIPIVVHAGLFWPRKKFMRYPGNFKVRVLKPIPAGIPRKIFFAELQEKMEHASNNLLLETIRDNPQLYIPASTKKALQHLRQ*****
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIMIFIRSLIFNIFFFIHIFIVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTTVQIEGVDNIPSTGCIIAIKHQSSWDTFYFLTCIQDPIFILKHTVFYIPIIGFYCFKQGMIGVKRNSKNLDMKSIINRAKKAVMDNRQLIIYPEGTRRSPGDMPIYKKGIAHIYESLSVPVIPIVVHAGLFWPRKKFMRYPGNFKVRVLKPIPAGIPRKIFFAELQEKMEHASNNLLLETIRDNPQLYIPASTKKALQHLRQIQNNS
MIMIFIRSLIFNIFFFIHIFIVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTTVQIEGVDNIPSTGCIIAIKHQSSWDTFYFLTCIQDPIFILKHTVFYIPIIGFYCFKQGMIGVKRNSKNLDMKSIINRAKKAVMDNRQLIIYPEGTRRSPGDMPIYKKGIAHIYESLSVPVIPIVVHAGLFWPRKKFMRYPGNFKVRVLKPIPAGIPRKIFFAELQEKMEHASNNLLLETIRDNPQLYIPASTKKALQHLRQIQNNS
MIMIFIRSLIFNIFFFIHIFIVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTTVQIEGVDNIPSTGCIIAIKHQSSWDTFYFLTCIQDPIFILKHTVFYIPIIGFYCFKQGMIGVKRNSKNLDMKSIINRAKKAVMDNRQLIIYPEGTRRSPGDMPIYKKGIAHIYESLSVPVIPIVVHAGLFWPRKKFMRYPGNFKVRVLKPIPAGIPRKIFFAELQEKMEHASNNLLLETIRDNPQLYIPASTKKALQHLRQIQNNS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target266 1-acyl-sn-glycerol-3-phosphate acyltransferase [Candida
315121773261 1-acyl-sn-glycerol-3-phosphate acyltransferase [Candida 1 1e-117
159185819265 1-acyl-sn-glycerol-3-phosphate acyltransferase [Agrobac 1 1e-66
227823234260 1-acylglycerol-3-phosphate O-acyltransferase [Sinorhizo 1 3e-66
332716397265 1-acyl-sn-glycerol-3-phosphate acyltransferase [Agrobac 1 4e-66
15966411260 putative 1-acyl-SN-glycerol-3-phosphate acyltransferase 1 4e-66
150397744259 phospholipid/glycerol acyltransferase [Sinorhizobium me 1 5e-66
209551151265 phospholipid/glycerol acyltransferase [Rhizobium legumi 1 4e-64
327193563265 1-acylglycerol-3-phosphate O-acyltransferase protein [R 1 1e-63
116254068271 acetyltransferase [Rhizobium leguminosarum bv. viciae 3 1 2e-63
218462838265 1-acyl-sn-glycerol-3-phosphate acyltransferase protein 1 2e-63
>gi|315121773|ref|YP_004062262.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 261 Back     alignment and organism information
 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/264 (77%), Positives = 232/264 (87%), Gaps = 3/264 (1%)

Query: 3   MIFIRSLIFNIFFFIHIFIVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTTVQ 62
           MIF+RSLIFN  F I+ F + +++LLL  F+TRKQCLY+AK WAH NQLLLKYIT+T +Q
Sbjct: 1   MIFVRSLIFNTLFLINTFAILIVLLLLNLFMTRKQCLYLAKIWAHTNQLLLKYITRTNIQ 60

Query: 63  IEGVDNIPSTGCIIAIKHQSSWDTFYFLTCIQDPIFILKHTVFYIPIIGFYCFKQGMIGV 122
           IEG++NIP TGCIIAIKHQSSWDTF+FLTCI+DPIFILKHTVFYIPIIG YC KQGMIG+
Sbjct: 61  IEGIENIPKTGCIIAIKHQSSWDTFFFLTCIEDPIFILKHTVFYIPIIGLYCIKQGMIGI 120

Query: 123 KRNSKNLDMKSIINRAKKAVMDNRQLIIYPEGTRRSPGDMPIYKKGIAHIYESLSVPVIP 182
           KRNS+ LDMK+IINRA+KA+  NRQLIIYPEGTRRSPGD P+YKKGIAHIY+SL+VPVIP
Sbjct: 121 KRNSRKLDMKTIINRAQKAITSNRQLIIYPEGTRRSPGDAPVYKKGIAHIYDSLAVPVIP 180

Query: 183 IVVHAGLFWPRKKFMRYPGNFKVRVLKPIPAGIPRKIFFAELQEKMEHASNNLLLETIRD 242
           IVVHAGLFWPR K MRYPGNFKVRVLKPIPAGIPR IFF +LQEKME+ SN LLLETI D
Sbjct: 181 IVVHAGLFWPRGKSMRYPGNFKVRVLKPIPAGIPRTIFFTDLQEKMEYESNKLLLETIHD 240

Query: 243 NPQLYIPASTKKALQHLRQIQNNS 266
           NPQL +P S +KA   LRQ+Q N+
Sbjct: 241 NPQLKLPKSAQKA---LRQLQENT 261


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159185819|ref|NP_357003.2| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Agrobacterium tumefaciens str. C58] Length = 265 Back     alignment and organism information
>gi|227823234|ref|YP_002827206.1| 1-acylglycerol-3-phosphate O-acyltransferase [Sinorhizobium fredii NGR234] Length = 260 Back     alignment and organism information
>gi|332716397|ref|YP_004443863.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Agrobacterium sp. H13-3] Length = 265 Back     alignment and organism information
>gi|15966411|ref|NP_386764.1| putative 1-acyl-SN-glycerol-3-phosphate acyltransferase (PLSC) protein [Sinorhizobium meliloti 1021] Length = 260 Back     alignment and organism information
>gi|150397744|ref|YP_001328211.1| phospholipid/glycerol acyltransferase [Sinorhizobium medicae WSM419] Length = 259 Back     alignment and organism information
>gi|209551151|ref|YP_002283068.1| phospholipid/glycerol acyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 265 Back     alignment and organism information
>gi|327193563|gb|EGE60453.1| 1-acylglycerol-3-phosphate O-acyltransferase protein [Rhizobium etli CNPAF512] Length = 265 Back     alignment and organism information
>gi|116254068|ref|YP_769906.1| acetyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 271 Back     alignment and organism information
>gi|218462838|ref|ZP_03502929.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase protein [Rhizobium etli Kim 5] Length = 265 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target266 1-acyl-sn-glycerol-3-phosphate acyltransferase [Candida
COG0204255 COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate acyltrans 2e-26
KOG2848276 KOG2848, KOG2848, KOG2848, 1-acyl-sn-glycerol-3-phospha 3e-23
PRK08633 1146 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanolamine 1e-08
smart00563118 smart00563, PlsC, Phosphate acyltransferases 2e-17
TIGR00530130 TIGR00530, AGP_acyltrn, 1-acyl-sn-glycerol-3-phosphate 9e-14
pfam01553132 pfam01553, Acyltransferase, Acyltransferase 2e-12
cd07988163 cd07988, LPLAT_ABO13168-like, Lysophospholipid Acyltran 2e-07
cd07990193 cd07990, LPLAT_LCLAT1-like, Lysophospholipid Acyltransf 4e-07
cd06551187 cd06551, LPLAT, Lysophospholipid acyltransferases (LPLA 1e-06
cd07992203 cd07992, LPLAT_AAK14816-like, Lysophospholipid Acyltran 2e-06
cd07991211 cd07991, LPLAT_LPCAT1-like, Lysophospholipid Acyltransf 4e-04
PLN02901214 PLN02901, PLN02901, 1-acyl-sn-glycerol-3-phosphate acyl 1e-15
PRK15018245 PRK15018, PRK15018, 1-acyl-sn-glycerol-3-phosphate acyl 3e-06
cd07989184 cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransfe 7e-30
KOG1505346 KOG1505, KOG1505, KOG1505, Lysophosphatidic acid acyltr 3e-09
PRK14014301 PRK14014, PRK14014, putative acyltransferase; Provision 9e-07
cd07987212 cd07987, LPLAT_MGAT-like, Lysophospholipid Acyltransfer 8e-05
>gnl|CDD|30553 COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|38059 KOG2848, KOG2848, KOG2848, 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181510 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>gnl|CDD|128835 smart00563, PlsC, Phosphate acyltransferases Back     alignment and domain information
>gnl|CDD|129621 TIGR00530, AGP_acyltrn, 1-acyl-sn-glycerol-3-phosphate acyltransferases Back     alignment and domain information
>gnl|CDD|110550 pfam01553, Acyltransferase, Acyltransferase Back     alignment and domain information
>gnl|CDD|153250 cd07988, LPLAT_ABO13168-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ABO13168 Back     alignment and domain information
>gnl|CDD|153252 cd07990, LPLAT_LCLAT1-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LCLAT1-like Back     alignment and domain information
>gnl|CDD|153244 cd06551, LPLAT, Lysophospholipid acyltransferases (LPLATs) of glycerophospholipid biosynthesis Back     alignment and domain information
>gnl|CDD|153254 cd07992, LPLAT_AAK14816-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown AAK14816-like Back     alignment and domain information
>gnl|CDD|153253 cd07991, LPLAT_LPCAT1-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LPCAT1-like Back     alignment and domain information
>gnl|CDD|178489 PLN02901, PLN02901, 1-acyl-sn-glycerol-3-phosphate acyltransferase Back     alignment and domain information
>gnl|CDD|184979 PRK15018, PRK15018, 1-acyl-sn-glycerol-3-phosphate acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|153251 cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like Back     alignment and domain information
>gnl|CDD|36718 KOG1505, KOG1505, KOG1505, Lysophosphatidic acid acyltransferase LPAAT and related acyltransferases [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184452 PRK14014, PRK14014, putative acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|153249 cd07987, LPLAT_MGAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: MGAT-like Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 266 1-acyl-sn-glycerol-3-phosphate acyltransferase [Candida
KOG2848276 consensus 100.0
COG0204255 PlsC 1-acyl-sn-glycerol-3-phosphate acyltransferase [Li 100.0
KOG1505346 consensus 99.86
cd07989184 LPLAT_AGPAT-like Lysophospholipid Acyltransferases (LPL 100.0
cd07992203 LPLAT_AAK14816-like Lysophospholipid Acyltransferases ( 100.0
cd07991211 LPLAT_LPCAT1-like Lysophospholipid Acyltransferases (LP 100.0
cd06551187 LPLAT Lysophospholipid acyltransferases (LPLATs) of gly 100.0
cd07988163 LPLAT_ABO13168-like Lysophospholipid Acyltransferases ( 100.0
PRK06814 1139 acylglycerophosphoethanolamine acyltransferase; Provisi 99.98
PRK08633 1150 2-acyl-glycerophospho-ethanolamine acyltransferase; Val 99.97
PRK08043 719 bifunctional acyl-[acyl carrier protein] synthetase/2-a 99.96
cd07986210 LPLAT_ACT14924-like Lysophospholipid Acyltransferases ( 99.95
cd07987212 LPLAT_MGAT-like Lysophospholipid Acyltransferases (LPLA 99.93
cd07993205 LPLAT_DHAPAT-like Lysophospholipid Acyltransferases (LP 99.9
PTZ00261355 acyltransferase; Provisional 99.81
cd07983189 LPLAT_DUF374-like Lysophospholipid Acyltransferases (LP 99.79
KOG2847286 consensus 99.67
PRK11915 621 glycerol-3-phosphate acyltransferase; Reviewed 99.57
PRK04974 815 glycerol-3-phosphate acyltransferase; Validated 99.52
PRK03355 774 glycerol-3-phosphate acyltransferase; Validated 99.49
COG2937 810 PlsB Glycerol-3-phosphate O-acyltransferase [Lipid meta 99.13
COG2121214 Uncharacterized protein conserved in bacteria [Function 99.01
KOG3729 715 consensus 98.97
PRK08419301 lipid A biosynthesis lauroyl acyltransferase; Reviewed 98.91
PRK06628290 lipid A biosynthesis lauroyl acyltransferase; Provision 98.87
PRK06553308 lipid A biosynthesis lauroyl acyltransferase; Provision 98.8
pfam03279295 Lip_A_acyltrans Bacterial lipid A biosynthesis acyltran 98.74
PRK06860309 lipid A biosynthesis lauroyl acyltransferase; Provision 98.7
PRK08943317 lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltra 98.69
LOAD_LSAT278 consensus 98.69
cd07984192 LPLAT_LABLAT-like Lysophospholipid Acyltransferases (LP 98.68
KOG3730 685 consensus 98.65
KOG2898354 consensus 98.65
COG1560308 HtrB Lauroyl/myristoyl acyltransferase [Cell envelope b 98.6
PRK08706289 lipid A biosynthesis lauroyl acyltransferase; Provision 98.57
PRK08733306 lipid A biosynthesis lauroyl acyltransferase; Provision 98.56
pfam03982297 DAGAT Diacylglycerol acyltransferase. The terminal step 98.53
PRK07920300 lipid A biosynthesis lauroyl acyltransferase; Provision 98.51
PRK05646310 lipid A biosynthesis lauroyl acyltransferase; Provision 98.5
PRK08905278 lipid A biosynthesis lauroyl acyltransferase; Validated 98.5
PRK08717311 consensus 98.46
PRK08025305 lipid A biosynthesis palmitoleoyl acyltransferase; Revi 98.44
PRK08024306 consensus 98.4
cd07985235 LPLAT_GPAT Lysophospholipid Acyltransferases (LPLATs) o 98.34
PRK06946293 lipid A biosynthesis lauroyl acyltransferase; Provision 97.68
TIGR02208307 lipid_A_msbB lipid A biosynthesis (KDO)2-(lauroyl)-lipi 97.49
TIGR02207308 lipid_A_htrB lipid A biosynthesis lauroyl (or palmitole 97.3
PRK05906 454 lipid A biosynthesis lauroyl acyltransferase; Provision 97.15
TIGR00530138 AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltransfer 100.0
pfam01553132 Acyltransferase Acyltransferase. This family contains a 99.97
smart00563118 PlsC Phosphate acyltransferases. Function in phospholip 99.94
cd07990193 LPLAT_LCLAT1-like Lysophospholipid Acyltransferases (LP 99.89
KOG4666 412 consensus 98.44
PRK08734305 lipid A biosynthesis lauroyl acyltransferase; Provision 98.04
COG3176292 Putative hemolysin [General function prediction only] 96.58
PRK05645295 lipid A biosynthesis lauroyl acyltransferase; Provision 95.9
KOG4321279 consensus 95.73
KOG4666412 consensus 92.32
KOG0831334 consensus 98.02
>KOG2848 consensus Back     alignment and domain information
>COG0204 PlsC 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG1505 consensus Back     alignment and domain information
>cd07989 LPLAT_AGPAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like Back     alignment and domain information
>cd07992 LPLAT_AAK14816-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown AAK14816-like Back     alignment and domain information
>cd07991 LPLAT_LPCAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LPCAT1-like Back     alignment and domain information
>cd06551 LPLAT Lysophospholipid acyltransferases (LPLATs) of glycerophospholipid biosynthesis Back     alignment and domain information
>cd07988 LPLAT_ABO13168-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ABO13168 Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>cd07986 LPLAT_ACT14924-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ACT14924 Back     alignment and domain information
>cd07987 LPLAT_MGAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: MGAT-like Back     alignment and domain information
>cd07993 LPLAT_DHAPAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT-like Back     alignment and domain information
>PTZ00261 acyltransferase; Provisional Back     alignment and domain information
>cd07983 LPLAT_DUF374-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: DUF374 Back     alignment and domain information
>KOG2847 consensus Back     alignment and domain information
>PRK11915 glycerol-3-phosphate acyltransferase; Reviewed Back     alignment and domain information
>PRK04974 glycerol-3-phosphate acyltransferase; Validated Back     alignment and domain information
>PRK03355 glycerol-3-phosphate acyltransferase; Validated Back     alignment and domain information
>COG2937 PlsB Glycerol-3-phosphate O-acyltransferase [Lipid metabolism] Back     alignment and domain information
>COG2121 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3729 consensus Back     alignment and domain information
>PRK08419 lipid A biosynthesis lauroyl acyltransferase; Reviewed Back     alignment and domain information
>PRK06628 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>PRK06553 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>pfam03279 Lip_A_acyltrans Bacterial lipid A biosynthesis acyltransferase Back     alignment and domain information
>PRK06860 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>PRK08943 lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase; Validated Back     alignment and domain information
>LOAD_LSAT consensus Back     alignment and domain information
>cd07984 LPLAT_LABLAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like Back     alignment and domain information
>KOG3730 consensus Back     alignment and domain information
>KOG2898 consensus Back     alignment and domain information
>COG1560 HtrB Lauroyl/myristoyl acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08706 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>PRK08733 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>pfam03982 DAGAT Diacylglycerol acyltransferase Back     alignment and domain information
>PRK07920 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>PRK05646 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>PRK08905 lipid A biosynthesis lauroyl acyltransferase; Validated Back     alignment and domain information
>PRK08717 consensus Back     alignment and domain information
>PRK08025 lipid A biosynthesis palmitoleoyl acyltransferase; Reviewed Back     alignment and domain information
>PRK08024 consensus Back     alignment and domain information
>cd07985 LPLAT_GPAT Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT Back     alignment and domain information
>PRK06946 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>TIGR02208 lipid_A_msbB lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase; InterPro: IPR011921 Bacterial lipopolysachharides (LPS) are glycolipids that make up the outer monolayer of the outer membranes of most Gram-negative bacteria Back     alignment and domain information
>TIGR02207 lipid_A_htrB lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase; InterPro: IPR011920 Bacterial lipopolysachharides (LPS) are glycolipids that make up the outer monolayer of the outer membranes of most Gram-negative bacteria Back     alignment and domain information
>PRK05906 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>TIGR00530 AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltransferases; InterPro: IPR004552 This domain describes the core homologous region of a collection of related proteins, several of which are known to act as 1-acyl-sn-glycerol-3-phosphate acyltransferases (2 Back     alignment and domain information
>pfam01553 Acyltransferase Acyltransferase Back     alignment and domain information
>smart00563 PlsC Phosphate acyltransferases Back     alignment and domain information
>cd07990 LPLAT_LCLAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LCLAT1-like Back     alignment and domain information
>KOG4666 consensus Back     alignment and domain information
>PRK08734 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>COG3176 Putative hemolysin [General function prediction only] Back     alignment and domain information
>PRK05645 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>KOG4321 consensus Back     alignment and domain information
>KOG4666 consensus Back     alignment and domain information
>KOG0831 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target266 1-acyl-sn-glycerol-3-phosphate acyltransferase [Candida
1iuq_A367 Glycerol-3-phosphate acyltransferase; open twisted alph 3e-07
>1iuq_A Glycerol-3-phosphate acyltransferase; open twisted alpha/beta, four helix bundle; 1.55A {Cucurbita moschata} SCOP: c.112.1.1 PDB: 1k30_A Length = 367 Back     alignment and structure
 Score = 50.7 bits (121), Expect = 3e-07
 Identities = 27/197 (13%), Positives = 57/197 (28%), Gaps = 34/197 (17%)

Query: 67  DNIP-STGCIIAIKHQSSWDTFYFLTCI--------QDPIFILKHTVFYIPIIGFYCFKQ 117
           + +      ++   HQ+  D       +        ++ IF+    V   P+   +   +
Sbjct: 124 EKLQQGHNVVLISNHQTEADPAIISLLLEKTNPYIAENTIFVAGDRVLADPLCKPFSIGR 183

Query: 118 GMIGVKRNSKNLDMKSI-----------INRAKKAVMDNRQLI-IYPEGTRRSPGDM--- 162
            +I V       D+  +           +      +    QLI I P G R  P      
Sbjct: 184 NLICVYSKKHMFDIPELTETKRKANTRSLKEMALLLRGGSQLIWIAPSGGRDRPDPSTGE 243

Query: 163 -------PIYKKGIAHIYESLSVP--VIPIVVH-AGLFWPRKKFMRYPGNFKVRVLKPIP 212
                        +  + +   VP  + P+ +    +  P  +     G  +V       
Sbjct: 244 WYPAPFDASSVDNMRRLIQHSDVPGHLFPLALLCHDIMPPPSQVEIEIGEKRVIAFNGAG 303

Query: 213 AGIPRKIFFAELQEKME 229
             +  +I F E+    +
Sbjct: 304 LSVAPEISFEEIAATHK 320


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target266 1-acyl-sn-glycerol-3-phosphate acyltransferase [Candida
1iuq_A367 Glycerol-3-phosphate acyltransferase; open twisted alph 99.95
>1iuq_A Glycerol-3-phosphate acyltransferase; open twisted alpha/beta, four helix bundle; 1.55A {Cucurbita moschata} SCOP: c.112.1.1 PDB: 1k30_A Back     alignment and structure
Probab=99.95  E-value=1.4e-27  Score=181.58  Aligned_cols=175  Identities=11%  Similarity=0.152  Sum_probs=125.2

Q ss_pred             CEEEEEEE-------ECCC-CEEEEEECCHHHHHHHHHHHHHC--------CCEEEEEECCCCCCCCHHEEECCEEEECC
Q ss_conf             18997400-------0046-70699817801201232245412--------42121342122433101100001034213
Q gi|255764499|r   60 TVQIEGVD-------NIPS-TGCIIAIKHQSSWDTFYFLTCIQ--------DPIFILKHTVFYIPIIGFYCFKQGMIGVK  123 (266)
Q Consensus        60 ~v~v~G~e-------~l~~-~~~iiv~NH~S~~D~~~l~~~~~--------~~~~i~K~el~~~P~~g~~~~~~g~i~vd  123 (266)
                      +-.+.|.+       ++++ +++|++|||+|++|++++..+++        +..|++|+++++.|++|++++..|+++|+
T Consensus       110 ~s~v~~~~~l~~~~E~l~~g~~VIlvsNHqS~~D~~il~~ll~~~~~~l~~~~~f~a~~~l~~~pl~~~~~~~~~~i~V~  189 (367)
T 1iuq_A          110 NSFVGNLSLFKDIEEKLQQGHNVVLISNHQTEADPAIISLLLEKTNPYIAENTIFVAGDRVLADPLCKPFSIGRNLICVY  189 (367)
T ss_dssp             GCEEECHHHHHHHHHHHHTTCEEEEEECCCCTTHHHHHHHHHTTTCHHHHHHCEEEECTHHHHCTTTHHHHHTSEEEECC
T ss_pred             CCEEECHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCHHHCEEEEEEHHHHHCHHHHHHHHHCCEEEEE
T ss_conf             54662688999999730489988998788314159999999621462343511788521564163799999878967996


Q ss_pred             CCHH-----------HHHHHHHHHHHHHHHHCCC-EEEEECCCCCCCCCC----C------CCCHHHHHHHHHHCCCE--
Q ss_conf             1010-----------0000013443344420133-023402564358520----0------21003567655435945--
Q gi|255764499|r  124 RNSK-----------NLDMKSIINRAKKAVMDNR-QLIIYPEGTRRSPGD----M------PIYKKGIAHIYESLSVP--  179 (266)
Q Consensus       124 R~~~-----------~~~~~~~~~~~~~~~~~g~-~i~iFPEGTr~~~~~----~------~~fk~G~f~lA~~~~~p--  179 (266)
                      |++.           .++....++.+.+.+++|. .+.|||||||++++.    .      ..+|.|++++|.++++|  
T Consensus       190 r~~~i~~~p~l~~~k~~~~~~al~~~~~~L~~g~~~i~IfPEGtRsr~~~~~g~~~p~~~~~~~k~g~~~La~~s~~p~~  269 (367)
T 1iuq_A          190 SKKHMFDIPELTETKRKANTRSLKEMALLLRGGSQLIWIAPSGGRDRPDPSTGEWYPAPFDASSVDNMRRLIQHSDVPGH  269 (367)
T ss_dssp             CGGGTTSSGGGHHHHHHHHHHHHHHHHHHHHHCCCEEEECTTCSCCCBCTTTCCBCCCCCCHHHHHHHHHHHHTSSSCEE
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCE
T ss_conf             48876667102245556679999999999964996999958877778776667657631013576799999971599967


Q ss_pred             EEEEEEEEEEEC-CCCC--------CCCCCCEEEEEECCCCCCC------CCHHHHHHHHHHHHHHHHHH
Q ss_conf             787865202544-6898--------6345857999964888898------99789999999999999999
Q gi|255764499|r  180 VIPIVVHAGLFW-PRKK--------FMRYPGNFKVRVLKPIPAG------IPRKIFFAELQEKMEHASNN  234 (266)
Q Consensus       180 IvPv~i~~~~~~-~~~~--------~~~~~g~v~v~~~~pI~~~------~~~~~~~~~l~~~i~~~~~~  234 (266)
                      |+||+++++... |...        .....+.|+|.||+||+..      .+.++..+.+.+.+.+++.+
T Consensus       270 IvPvai~~~d~~pp~~~~~~~ige~r~~~~~~V~V~~G~pId~~~~~~~~~~~~e~~~~~t~~i~d~v~e  339 (367)
T 1iuq_A          270 LFPLALLCHDIMPPPSQVEIEIGEKRVIAFNGAGLSVAPEISFEEIAATHKNPEEVREAYSKALFDSVAM  339 (367)
T ss_dssp             EEEEEEECGGGSCCC----------CCCCCBCCEEEECCCCCHHHHHHTSSSHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCEEEEECCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9944551552458975320000201457778538997498657776422344067899999999999999




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 266 1-acyl-sn-glycerol-3-phosphate acyltransferase [Candida
d1iuqa_367 c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase 6e-09
>d1iuqa_ c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]} Length = 367 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Glycerol-3-phosphate (1)-acyltransferase
superfamily: Glycerol-3-phosphate (1)-acyltransferase
family: Glycerol-3-phosphate (1)-acyltransferase
domain: Glycerol-3-phosphate (1)-acyltransferase
species: Cushaw squash (Cucurbita moschata) [TaxId: 3662]
 Score = 55.0 bits (132), Expect = 6e-09
 Identities = 26/200 (13%), Positives = 58/200 (29%), Gaps = 34/200 (17%)

Query: 64  EGVDNIP-STGCIIAIKHQSSWDTFYFLTCI--------QDPIFILKHTVFYIPIIGFYC 114
           +  + +      ++   HQ+  D       +        ++ IF+    V   P+   + 
Sbjct: 121 DIEEKLQQGHNVVLISNHQTEADPAIISLLLEKTNPYIAENTIFVAGDRVLADPLCKPFS 180

Query: 115 FKQGMIGVKRNSKNLDMKSIINRAKKAVMDNRQ------------LIIYPEGTRRSPGDM 162
             + +I V       D+  +    +KA   + +            + I P G R  P   
Sbjct: 181 IGRNLICVYSKKHMFDIPELTETKRKANTRSLKEMALLLRGGSQLIWIAPSGGRDRPDPS 240

Query: 163 ----------PIYKKGIAHIYESLSVP--VIPIVVHAGLFWPR-KKFMRYPGNFKVRVLK 209
                           +  + +   VP  + P+ +      P   +     G  +V    
Sbjct: 241 TGEWYPAPFDASSVDNMRRLIQHSDVPGHLFPLALLCHDIMPPPSQVEIEIGEKRVIAFN 300

Query: 210 PIPAGIPRKIFFAELQEKME 229
                +  +I F E+    +
Sbjct: 301 GAGLSVAPEISFEEIAATHK 320


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target266 1-acyl-sn-glycerol-3-phosphate acyltransferase [Candida
d1iuqa_367 Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash 99.94
>d1iuqa_ c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Glycerol-3-phosphate (1)-acyltransferase
superfamily: Glycerol-3-phosphate (1)-acyltransferase
family: Glycerol-3-phosphate (1)-acyltransferase
domain: Glycerol-3-phosphate (1)-acyltransferase
species: Cushaw squash (Cucurbita moschata) [TaxId: 3662]
Probab=99.94  E-value=6e-28  Score=182.31  Aligned_cols=148  Identities=14%  Similarity=0.227  Sum_probs=111.8

Q ss_pred             EEECCC-CEEEEEECCHHHHHHHHHHHHH--------CCCEEEEEECCCCCCCCHHEEECCEEEECCCCHH---------
Q ss_conf             000046-7069981780120123224541--------2421213421224331011000010342131010---------
Q gi|255764499|r   66 VDNIPS-TGCIIAIKHQSSWDTFYFLTCI--------QDPIFILKHTVFYIPIIGFYCFKQGMIGVKRNSK---------  127 (266)
Q Consensus        66 ~e~l~~-~~~iiv~NH~S~~D~~~l~~~~--------~~~~~i~K~el~~~P~~g~~~~~~g~i~vdR~~~---------  127 (266)
                      .|++++ +++|++|||||++|++++..++        .+..|++|+++++.|++|+++...|+|+|+|++.         
T Consensus       123 ~Ekl~~g~nVIlvSNHqS~~D~~il~~ll~~~~~~l~r~i~f~Ak~~l~~~Pl~~~f~~~~g~I~V~rk~~i~~~p~l~~  202 (367)
T d1iuqa_         123 EEKLQQGHNVVLISNHQTEADPAIISLLLEKTNPYIAENTIFVAGDRVLADPLCKPFSIGRNLICVYSKKHMFDIPELTE  202 (367)
T ss_dssp             HHHHHTTCEEEEEECCCCTTHHHHHHHHHTTTCHHHHHHCEEEECTHHHHCTTTHHHHHTSEEEECCCGGGTTSSGGGHH
T ss_pred             HHHHCCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCCCCEEEEEEHHHHCCHHHHHHHHHCCEEEEECCCCCCCCCCCCC
T ss_conf             99860799779987885400389999998512656210338985455622577899997488789954654445631010


Q ss_pred             ---HHHHHHHHHHHHHHHHCC-CEEEEECCCCCCC----CCCC--CCCHHHH----HHHHHHCCCE--EEEEEEEEEEEC
Q ss_conf             ---000001344334442013-3023402564358----5200--2100356----7655435945--787865202544
Q gi|255764499|r  128 ---NLDMKSIINRAKKAVMDN-RQLIIYPEGTRRS----PGDM--PIYKKGI----AHIYESLSVP--VIPIVVHAGLFW  191 (266)
Q Consensus       128 ---~~~~~~~~~~~~~~~~~g-~~i~iFPEGTr~~----~~~~--~~fk~G~----f~lA~~~~~p--IvPv~i~~~~~~  191 (266)
                         +++. ..++.+.+.+++| .+++|||||||++    +|.+  .+|++|+    +++|..+++|  |+||++.++...
T Consensus       203 ~~~~~~~-~al~~~~~lL~~Gg~~v~IfPEGTRsr~~~~dg~l~p~~F~~~~~~~~~~LA~~sgvP~hV~Pvai~~~d~~  281 (367)
T d1iuqa_         203 TKRKANT-RSLKEMALLLRGGSQLIWIAPSGGRDRPDPSTGEWYPAPFDASSVDNMRRLIQHSDVPGHLFPLALLCHDIM  281 (367)
T ss_dssp             HHHHHHH-HHHHHHHHHHHHCCCEEEECTTCSCCCBCTTTCCBCCCCCCHHHHHHHHHHHHTSSSCEEEEEEEEECGGGS
T ss_pred             HHHHHHH-HHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCEEECHHHHCCCCC
T ss_conf             0223326-889999998616875999945676467666666505665575505899999855799956856044133425


Q ss_pred             CCC-C--------CCCCCCEEEEEECCCCCCC
Q ss_conf             689-8--------6345857999964888898
Q gi|255764499|r  192 PRK-K--------FMRYPGNFKVRVLKPIPAG  214 (266)
Q Consensus       192 ~~~-~--------~~~~~g~v~v~~~~pI~~~  214 (266)
                      +.. .        ...+.+.+.+.+|+||+..
T Consensus       282 pP~~~v~~~ige~R~~~~~~V~i~~G~pId~~  313 (367)
T d1iuqa_         282 PPPSQVEIEIGEKRVIAFNGAGLSVAPEISFE  313 (367)
T ss_dssp             CCC----------CCCCCBCCEEEECCCCCHH
T ss_pred             CCCCCCCCCHHHCCCCCCCCEEEEECCCCCHH
T ss_conf             88754332000103667786148867973566



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 266 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ca
1iuq_A_80-367288 (A:80-367) Glycerol-3-phosphate acyltransferase; o 3e-17
>1iuq_A (A:80-367) Glycerol-3-phosphate acyltransferase; open twisted alpha/beta, four helix bundle; 1.55A {Cucurbita moschata}Length = 288 Back     alignment and structure
 Score = 83.2 bits (204), Expect = 3e-17
 Identities = 24/286 (8%), Positives = 63/286 (22%), Gaps = 58/286 (20%)

Query: 13  IFFFIHIFIVSMIVLLLCCFITRKQCLYIAKKWAHVNQLLLKYITKTTVQIEGVDNIPST 72
           +F   H  I                 ++       +      ++   ++  +  + +   
Sbjct: 1   VFSSHHKAI----------REPFDYYIFGQNYIRPLIDFGNSFVGNLSLFKDIEEKLQQG 50

Query: 73  G-CIIAIKHQSSWDTFYFLTCI--------QDPIFILKHTVFYIPIIGFYCFKQGMIGVK 123
              ++   HQ+  D       +        ++ IF+    V   P+   +   + +I V 
Sbjct: 51  HNVVLISNHQTEADPAIISLLLEKTNPYIAENTIFVAGDRVLADPLCKPFSIGRNLICVY 110

Query: 124 RNS------------KNLDMKSIINRAKKAVMDNRQLIIYPEGTRRSPGDM--------- 162
                          +  + +S+   A      ++ + I P G R  P            
Sbjct: 111 SKKHXFDIPELTETKRKANTRSLKEXALLLRGGSQLIWIAPSGGRDRPDPSTGEWYPAPF 170

Query: 163 -PIYKKGIAHIYESLSVPVIPIVVHA-----------GLFWPRKKFMRYPGNFKVRVLKP 210
                     + +   VP     +                   +K +       + V   
Sbjct: 171 DASSVDNXRRLIQHSDVPGHLFPLALLCHDIXPPPSQVEIEIGEKRVIAFNGAGLSVAPE 230

Query: 211 IP------AGIPRKIFFAELQEKMEHASNNLLLETIRDNPQLYIPA 250
           I            +       + +  +                   
Sbjct: 231 ISFEEIAATHKNPEEVREAYSKALFDSVAXQYNVLKTAISGKQGLG 276


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target266 1-acyl-sn-glycerol-3-phosphate acyltransferase [Candida
1iuq_A_80-367288 Glycerol-3-phosphate acyltransferase; open twisted 99.97
>1iuq_A (A:80-367) Glycerol-3-phosphate acyltransferase; open twisted alpha/beta, four helix bundle; 1.55A {Cucurbita moschata} Back     alignment and structure
Probab=99.97  E-value=1.3e-32  Score=212.14  Aligned_cols=184  Identities=12%  Similarity=0.100  Sum_probs=134.3

Q ss_pred             CEEEEEEEECC-CCEEEEEECCHHHHHHHHHHHHHC--------CCEEEEEECCCCCCCCHHEEECCEEEECCCCHHH--
Q ss_conf             18997400004-670699817801201232245412--------4212134212243310110000103421310100--
Q gi|255764499|r   60 TVQIEGVDNIP-STGCIIAIKHQSSWDTFYFLTCIQ--------DPIFILKHTVFYIPIIGFYCFKQGMIGVKRNSKN--  128 (266)
Q Consensus        60 ~v~v~G~e~l~-~~~~iiv~NH~S~~D~~~l~~~~~--------~~~~i~K~el~~~P~~g~~~~~~g~i~vdR~~~~--  128 (266)
                      ++.++|.++++ ++++|+++||+|++|++++..++.        ++.|++|+++++.|++||+++..|+|||||++..  
T Consensus        38 ~~~~~~~~~~~~~~~~i~v~NH~s~~D~~~l~~~l~~~~~~~~~~~~~va~~~l~~~p~~g~~~~~~g~i~v~R~~~~~~  117 (288)
T 1iuq_A           38 SLFKDIEEKLQQGHNVVLISNHQTEADPAIISLLLEKTNPYIAENTIFVAGDRVLADPLCKPFSIGRNLICVYSKKHXFD  117 (288)
T ss_dssp             HHHHHHHHHHHTTCEEEEEECCCCTTHHHHHHHHHTTTCHHHHHHCEEEECTHHHHCTTTHHHHHTSEEEECCCGGGTTS
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCHHHCEEEEEEHHHCCCHHHHHHHHHCCEEEEECCCCCCC
T ss_conf             89999999643799889986874330599999997335633202338997603403567899998689779964787777


Q ss_pred             ----------HHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCC------CCCHH----HHHHHHHHCCCEEEEEEEEEE
Q ss_conf             ----------0000134433444201330234025643585200------21003----567655435945787865202
Q gi|255764499|r  129 ----------LDMKSIINRAKKAVMDNRQLIIYPEGTRRSPGDM------PIYKK----GIAHIYESLSVPVIPIVVHAG  188 (266)
Q Consensus       129 ----------~~~~~~~~~~~~~~~~g~~i~iFPEGTr~~~~~~------~~fk~----G~f~lA~~~~~pIvPv~i~~~  188 (266)
                                ++.+++.+.+.+.+++|.+++|||||||+.++..      .+|++    |++++|.++++||+|+.+++.
T Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~~l~~g~~iliFPEGtrs~~~~~~~~~~~~~f~~g~~~~~~~la~~~~~pv~pv~i~~~  197 (288)
T 1iuq_A          118 IPELTETKRKANTRSLKEXALLLRGGSQLIWIAPSGGRDRPDPSTGEWYPAPFDASSVDNXRRLIQHSDVPGHLFPLALL  197 (288)
T ss_dssp             SGGGHHHHHHHHHHHHHHHHHHHHHCCCEEEECTTCSCCCBCTTTCCBCCCCCCHHHHHHHHHHHHTSSSCEEEEEEEEE
T ss_pred             CHHHHHHHHHCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEEC
T ss_conf             61344554111199999999999768859999468874676444576167645530467899987623999548967660


Q ss_pred             ---EECCC--------CCCCCCCCEEEEEECCCCCCC------CCHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             ---54468--------986345857999964888898------99789999999999999999999987507
Q gi|255764499|r  189 ---LFWPR--------KKFMRYPGNFKVRVLKPIPAG------IPRKIFFAELQEKMEHASNNLLLETIRDN  243 (266)
Q Consensus       189 ---~~~~~--------~~~~~~~g~v~v~~~~pI~~~------~~~~~~~~~l~~~i~~~~~~l~~e~~~~~  243 (266)
                         ..++.        ..+...++++++++|+||++.      +..++..+.+++.+++.++....|.....
T Consensus       198 ~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~pi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  269 (288)
T 1iuq_A          198 CHDIXPPPSQVEIEIGEKRVIAFNGAGLSVAPEISFEEIAATHKNPEEVREAYSKALFDSVAXQYNVLKTAI  269 (288)
T ss_dssp             CGGGSCCC----------CCCCCBCCEEEECCCCCHHHHHHTSSSHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             454469975333223422456776359997798567775322125689999999999999999999999987