254780579

254780579

hypothetical protein CLIBASIA_02330

GeneID in NCBI database:8209576Locus tag:CLIBASIA_02330
Protein GI in NCBI database:254780579Protein Accession:YP_003064992.1
Gene range:-(702176, 702799)Protein Length:207aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEEITVK
cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHccccccccccEEEcccccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHEEcccHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHccccHHHHHHEEcccHHccccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcHcccccccHEEEEHHHEEcc
MRYFWYGLFVCLIFFIMGFISFIRYVKqmhipdhpsvSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSvskdillqkipirqDLAECCIDIGYKalntegnaqEASAWAEKNNFHHVLIVthdyhmprtFLELQRINstvqfipypiishdleenssifKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEEITVK
MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEEITVK
MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIlrvllieylkilllsiqlslstqtASQFFITLIEEITVK
MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQT*******LIEE****
MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEEITVK
MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEEITVK
oooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEEITVK
MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEEITVK
MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEEITVK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target207 hypothetical protein CLIBASIA_02330 [Candidatus Liberib
315121772188 hypothetical protein CKC_00110 [Candidatus Liberibacter 1 7e-75
218680941216 hypothetical protein RetlC8_19678 [Rhizobium etli CIAT 1 1e-35
241206553238 hypothetical protein Rleg_3867 [Rhizobium leguminosarum 1 2e-35
218462839236 hypothetical protein RetlK5_26822 [Rhizobium etli Kim 5 1 2e-35
239833000302 Hypothetical protein, conserved [Ochrobactrum intermedi 1 2e-35
222149964246 hypothetical protein Avi_4029 [Agrobacterium vitis S4] 1 2e-35
153008321302 hypothetical protein Oant_0986 [Ochrobactrum anthropi A 1 3e-35
209551150238 hypothetical protein Rleg2_3574 [Rhizobium leguminosaru 1 3e-35
116254067236 transmembrane protein [Rhizobium leguminosarum bv. vici 1 5e-35
190893641236 hypothetical protein RHECIAT_CH0004075 [Rhizobium etli 1 8e-34
>gi|315121772|ref|YP_004062261.1| hypothetical protein CKC_00110 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 188 Back     alignment and organism information
 Score =  283 bits (725), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 160/186 (86%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           MRY WY L  CLIFFI GF+ FI+Y+ Q+ IP +PS++AIVVLTGEP RIE+AFELLEN+
Sbjct: 1   MRYLWYSLAACLIFFIGGFVLFIQYIVQIPIPANPSINAIVVLTGEPNRIEKAFELLENK 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           IG+++FISGVHHSVSKDILLQKIPIR+DLAECC+DIGYKALNT GNA+EA  W  K+++H
Sbjct: 61  IGQRVFISGVHHSVSKDILLQKIPIRKDLAECCVDIGYKALNTAGNAKEALEWIRKHDYH 120

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           HVLI+THDYH+PR  LEL R NS  +F+PYPII+HDL++N+ I  +K+LR+  IEYLKIL
Sbjct: 121 HVLIITHDYHIPRILLELNRKNSMTKFVPYPIITHDLQKNTLILYMKMLRMTFIEYLKIL 180

Query: 181 LLSIQL 186
           LLS+Q+
Sbjct: 181 LLSLQI 186


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218680941|ref|ZP_03528838.1| hypothetical protein RetlC8_19678 [Rhizobium etli CIAT 894] Length = 216 Back     alignment and organism information
>gi|241206553|ref|YP_002977649.1| hypothetical protein Rleg_3867 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 238 Back     alignment and organism information
>gi|218462839|ref|ZP_03502930.1| hypothetical protein RetlK5_26822 [Rhizobium etli Kim 5] Length = 236 Back     alignment and organism information
>gi|239833000|ref|ZP_04681329.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 302 Back     alignment and organism information
>gi|222149964|ref|YP_002550921.1| hypothetical protein Avi_4029 [Agrobacterium vitis S4] Length = 246 Back     alignment and organism information
>gi|153008321|ref|YP_001369536.1| hypothetical protein Oant_0986 [Ochrobactrum anthropi ATCC 49188] Length = 302 Back     alignment and organism information
>gi|209551150|ref|YP_002283067.1| hypothetical protein Rleg2_3574 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 238 Back     alignment and organism information
>gi|116254067|ref|YP_769905.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 236 Back     alignment and organism information
>gi|190893641|ref|YP_001980183.1| hypothetical protein RHECIAT_CH0004075 [Rhizobium etli CIAT 652] Length = 236 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target207 hypothetical protein CLIBASIA_02330 [Candidatus Liberib
pfam02698148 pfam02698, DUF218, DUF218 domain 9e-18
cd06259150 cd06259, YdcF-like, YdcF-like 1e-20
COG1434223 COG1434, COG1434, Uncharacterized conserved protein [Fu 5e-12
>gnl|CDD|145708 pfam02698, DUF218, DUF218 domain Back     alignment and domain information
>gnl|CDD|99750 cd06259, YdcF-like, YdcF-like Back     alignment and domain information
>gnl|CDD|31623 COG1434, COG1434, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 207 hypothetical protein CLIBASIA_02330 [Candidatus Liberib
PRK10494259 hypothetical protein; Provisional 100.0
pfam02698148 DUF218 DUF218 domain. This large family of proteins con 99.97
cd06259150 YdcF-like YdcF-like. YdcF-like is a large family of mai 99.97
COG1434223 Uncharacterized conserved protein [Function unknown] 99.91
PRK10834239 hypothetical protein; Provisional 99.83
COG2949235 SanA Uncharacterized membrane protein [Function unknown 99.6
KOG4533317 consensus 94.84
cd05015158 SIS_PGI_1 Phosphoglucose isomerase (PGI) contains two S 92.9
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase 91.98
PRK00179 525 pgi glucose-6-phosphate isomerase; Reviewed 94.18
>PRK10494 hypothetical protein; Provisional Back     alignment and domain information
>pfam02698 DUF218 DUF218 domain Back     alignment and domain information
>cd06259 YdcF-like YdcF-like Back     alignment and domain information
>COG1434 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10834 hypothetical protein; Provisional Back     alignment and domain information
>COG2949 SanA Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>KOG4533 consensus Back     alignment and domain information
>cd05015 SIS_PGI_1 Phosphoglucose isomerase (PGI) contains two SIS (Sugar ISomerase) domains Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>PRK00179 pgi glucose-6-phosphate isomerase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target207 hypothetical protein CLIBASIA_02330 [Candidatus Liberib
3ca8_A266 Protein YDCF; two domains, alpha/beta fold, helix bundl 2e-12
>3ca8_A Protein YDCF; two domains, alpha/beta fold, helix bundle, structural genomics, structure 2 function project, S2F, unknown function; 1.80A {Escherichia coli K12} Length = 266 Back     alignment and structure
 Score = 67.3 bits (164), Expect = 2e-12
 Identities = 25/163 (15%), Positives = 48/163 (29%), Gaps = 37/163 (22%)

Query: 32  PDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFISGVHHS----------------- 73
                   +++        I+ A ++  +Q    +   G+ HS                 
Sbjct: 32  EVPYQADCVILAGNAVMPTIDAACKIARDQQIPLLISGGIGHSTTFLYSAIAQHPHYNTI 91

Query: 74  ---------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN--NFHHV 122
                    +  DI  Q   I        I I  ++ N   NA+ + A   +     H  
Sbjct: 92  RTTGRAEATILADIAHQFWHI----PHEKIWIEDQSTNCGENARFSIALLNQAVERVHTA 147

Query: 123 LIVTHDYHMPRTFLELQRI----NSTVQFIPYPIISHDLEENS 161
           ++V       RT    +R+        +++ YP     L  N+
Sbjct: 148 IVVQDPTMQRRTMATFRRMTGDNPDAPRWLSYPGFVPQLGNNA 190


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target207 hypothetical protein CLIBASIA_02330 [Candidatus Liberib
3ca8_A266 Protein YDCF; two domains, alpha/beta fold, helix bundl 99.95
1rcu_A195 Conserved hypothetical protein VT76; structural genomic 92.14
>3ca8_A Protein YDCF; two domains, alpha/beta fold, helix bundle, structural genomics, structure 2 function project, S2F, unknown function; 1.80A {Escherichia coli K12} Back     alignment and structure
Probab=99.95  E-value=1.2e-25  Score=175.46  Aligned_cols=149  Identities=15%  Similarity=0.151  Sum_probs=122.0

Q ss_pred             CCCCCCCCCEEEEECCC-HHHHHHHHHHHHHCCCCCEECCCCC---------------------CCCCHHHHHHHHHHHC
Q ss_conf             67654568789994698-5799999999996899824515876---------------------5467899999876515
Q gi|254780579|r   30 HIPDHPSVSAIVVLTGE-PIRIERAFELLENQIGEKIFISGVH---------------------HSVSKDILLQKIPIRQ   87 (207)
Q Consensus        30 ~~~~~~~~DaIVVLgGg-~~Ri~~a~~L~~~g~~~~ii~SG~~---------------------~~~~~~~~~~~~~~~~   87 (207)
                      ....+.++|+||||||+ ..|.+.|++||++|.++.|+.+|.+                     .+.+|+++++.++.+.
T Consensus        30 ~~~~p~~aD~IVvlG~~~l~~~~~A~~L~~~g~a~liisGG~G~~T~~l~~~i~~~~~~~~i~~~g~sEAe~~a~~a~~~  109 (266)
T 3ca8_A           30 SGEVPYQADCVILAGNAVMPTIDAACKIARDQQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRTTGRAEATILADIAHQF  109 (266)
T ss_dssp             TTTCCCCCSEEEEESCCCHHHHHHHHHHHHHHTCCEEEECCSSTTHHHHHHHHHTCTTGGGSCCTTSCHHHHHHHHHHHT
T ss_pred             CCCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             66788899989988998218999999999805998897369875531456554306544556778988999999999997


Q ss_pred             -CCCHHHEECCCCCCCHHHHHHHHHHHHHHCC--CCEEEEECCHHHHHHHHHHHHHHCCC----CEEEEEECCCCCC---
Q ss_conf             -8861332204666660256999999998649--98189851144219999999986299----8799964167666---
Q gi|254780579|r   88 -DLAECCIDIGYKALNTEGNAQEASAWAEKNN--FHHVLIVTHDYHMPRTFLELQRINST----VQFIPYPIISHDL---  157 (207)
Q Consensus        88 -~i~~~~I~~e~~s~~T~ena~~~~~~l~~~~--~~~iiLVTs~yHm~RA~~~f~~~~p~----i~i~~~pv~~~~~---  157 (207)
                       |+++++|++|++|+||.|||.++++++++++  +++++||||+|||+||.++|++..++    .++..+|+.....   
T Consensus       110 ~GVp~~~Il~E~~S~NT~eNa~~s~~lL~~~~~~~~siilV~~p~h~rRa~atf~k~~~~~~~~~~~~s~p~~~~~~~~~  189 (266)
T 3ca8_A          110 WHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQRRTMATFRRMTGDNPDAPRWLSYPGFVPQLGNN  189 (266)
T ss_dssp             TCCCGGGEEEECCCCSHHHHHHHHHHHHHTCSSCCSCEEEECCTTTHHHHHHHHHHHHCCCTTSCSEEECCSSCCCEEEE
T ss_pred             CCCCHHHEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEC
T ss_conf             49999996646777778999999999999639998779998988999999999999747777775220378731489853


Q ss_pred             --------CCCCCCCCHHHHHHHHHHHHH
Q ss_conf             --------754211698999999999999
Q gi|254780579|r  158 --------EENSSIFKIKILRVLLIEYLK  178 (207)
Q Consensus       158 --------~~~~Ww~~~~~~~~~~~Ey~K  178 (207)
                              .....|.-...+..++.|+-.
T Consensus       190 ~~~~~~~~~~~~~w~~~r~i~~l~Ge~~R  218 (266)
T 3ca8_A          190 ADSVIFINQLQGLWPVERYLSLLTGELPR  218 (266)
T ss_dssp             TTEEEESSCCTTCCCHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHCCHHH
T ss_conf             88720066643437798999999620665



>1rcu_A Conserved hypothetical protein VT76; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.50A {Thermotoga maritima} SCOP: c.129.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 207 hypothetical protein CLIBASIA_02330 [Candidatus Li
3ca8_A_32-182151 (A:32-182) Protein YDCF; two domains, alpha/beta f 2e-14
>3ca8_A (A:32-182) Protein YDCF; two domains, alpha/beta fold, helix bundle, structural genomics, structure 2 function project, S2F, unknown function; 1.80A {Escherichia coli K12}Length = 151 Back     alignment and structure
 Score = 73.6 bits (180), Expect = 2e-14
 Identities = 18/143 (12%), Positives = 39/143 (27%), Gaps = 25/143 (17%)

Query: 35  PSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPI-------- 85
                +++        I+ A ++  +Q    +   G+ HS +                  
Sbjct: 4   YQADCVILAGNAVMPTIDAACKIARDQQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRTT 63

Query: 86  --------------RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDY 129
                            +    I I  ++ N   NA+ + A   +     H  ++V    
Sbjct: 64  GRAEATILADIAHQFWHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPT 123

Query: 130 HMPRTFLELQRINSTVQFIPYPI 152
              RT    +R+       P  +
Sbjct: 124 MQRRTMATFRRMTGDNPDAPRWL 146


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target207 hypothetical protein CLIBASIA_02330 [Candidatus Liberib
3ca8_A_32-182151 Protein YDCF; two domains, alpha/beta fold, helix 99.95
2cxn_A_103-289187 Glucose-6-phosphate isomerase; 1.40A {Mus musculus 93.22
2wu8_A_93-282190 Glucose-6-phosphate isomerase; gluconeogenesis, 5- 92.43
3hjb_A_126-311186 Glucose-6-phosphate isomerase; PGI, IDP01329, cyto 92.38
2o2c_A_168-342175 GPI, glucose-6-phosphate isomerase, glycosomal, PG 90.29
>3ca8_A (A:32-182) Protein YDCF; two domains, alpha/beta fold, helix bundle, structural genomics, structure 2 function project, S2F, unknown function; 1.80A {Escherichia coli K12} Back     alignment and structure
Probab=99.95  E-value=2.2e-27  Score=187.12  Aligned_cols=123  Identities=15%  Similarity=0.131  Sum_probs=109.5

Q ss_pred             CCCCCCCEEEEECCCH-HHHHHHHHHHHHCCCCCEECCCCC---------------------CCCCHHHHHHHHHHHC-C
Q ss_conf             6545687899946985-799999999996899824515876---------------------5467899999876515-8
Q gi|254780579|r   32 PDHPSVSAIVVLTGEP-IRIERAFELLENQIGEKIFISGVH---------------------HSVSKDILLQKIPIRQ-D   88 (207)
Q Consensus        32 ~~~~~~DaIVVLgGg~-~Ri~~a~~L~~~g~~~~ii~SG~~---------------------~~~~~~~~~~~~~~~~-~   88 (207)
                      +.++++|+|||||||. .|.+.|++|+++|+++.++++|+.                     ...+|++.|++++.+. |
T Consensus         1 d~~~~~d~ivVLG~~~~~r~~~a~~l~~~~~a~~i~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~sEA~~m~~~l~~~~G   80 (151)
T 3ca8_A            1 EVPYQADCVILAGNAVMPTIDAACKIARDQQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRTTGRAEATILADIAHQFWH   80 (151)
T ss_dssp             TCCCCCSEEEEESCCCHHHHHHHHHHHHHHTCCEEEECCSSTTHHHHHHHHHTCTTGGGSCCTTSCHHHHHHHHHHHTTC
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             77889898998189841889999999983598889617987454104444312666666788998899999999999649


Q ss_pred             CCHHHEECCCCCCCHHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             86133220466666025699999999864--9981898511442199999999862998799964167
Q gi|254780579|r   89 LAECCIDIGYKALNTEGNAQEASAWAEKN--NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS  154 (207)
Q Consensus        89 i~~~~I~~e~~s~~T~ena~~~~~~l~~~--~~~~iiLVTs~yHm~RA~~~f~~~~p~i~i~~~pv~~  154 (207)
                      +|+++|++|++|+||.|||.+++++++++  ++++++||||+|||+||.++|++.++++..++++++.
T Consensus        81 vp~~~I~~e~~s~~T~eNa~~~~~~l~~~~~~~~~iilVTs~~H~~Ra~~~~~~~~~~~~~~~~~~~~  148 (151)
T 3ca8_A           81 IPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQRRTMATFRRMTGDNPDAPRWLSY  148 (151)
T ss_dssp             CCGGGEEEECCCCSHHHHHHHHHHHHHTCSSCCSCEEEECCTTTHHHHHHHHHHHHCCCTTSCSEEEC
T ss_pred             CCHHHEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEECC
T ss_conf             98999552788778899999999999963999887999898888999999999975767777402126



>2cxn_A (A:103-289) Glucose-6-phosphate isomerase; 1.40A {Mus musculus} PDB: 2cvp_A 2cxo_A* 2cxp_A* 2cxq_A* 2cxr_A* 2cxs_A* 2cxt_A* 2cxu_A 1u0e_A 1u0f_A* 1u0g_A* 1jiq_A 1iri_A 1nuh_A* 1jlh_A 1iat_A 1hm5_A 1g98_A 1hox_A* 1xtb_A* ... Back     alignment and structure
>2wu8_A (A:93-282) Glucose-6-phosphate isomerase; gluconeogenesis, 5-phosphoarabinonate (PAB), PGI, cytoplasm, glycolysis; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3hjb_A (A:126-311) Glucose-6-phosphate isomerase; PGI, IDP01329, cytoplasm, gluconeogenesis, glycolysis, structural genomics; HET: PG4; 1.50A {Vibrio cholerae} Back     alignment and structure
>2o2c_A (A:168-342) GPI, glucose-6-phosphate isomerase, glycosomal, PGI, phosphohexose; dimer; HET: G6Q; 1.58A {Trypanosoma brucei brucei} PDB: 2o2d_A* 1q50_A Back     alignment and structure