255764504

255764504

DNA-methyltransferase MKpn2kI

GeneID in NCBI database:8209512Locus tag:CLIBASIA_02020
Protein GI in NCBI database:255764504Protein Accession:YP_003064930.2
Gene range:-(762494, 762799)Protein Length:101aa
Gene description:DNA-methyltransferase MKpn2kI
COG prediction:[L] Site-specific DNA methylase
KEGG prediction:DNA-methyltransferase MKpn2kI; K00558 DNA (cytosine-5-)-methyltransferase [EC:2.1.1.37]
SEED prediction:Cytosine-specific methyltransferase NlaX (EC 2.1.1.37) (M.NlaX)
Pathway involved in KEGG:Cysteine and methionine metabolism [PATH:las00270]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI
ccHHHccccccccEEEEEEEEcccccccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccEEEEccccccccccccccccccccc
cccHHcccccccEEEEEEEEccccccccccccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccEccccccEEEEEccEccccccc
mkacdfgvpqrrERLYIIDflnpsvefkfptplgikprlGDILeehiddkstisNKLWEGhqkrkennkiagkgfgyglFFENSATTNTLSARyykdgsei
mkacdfgvpqrrERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKstisnklweghqkrkennkiagKGFGYGLFfensattntlsaryykdgsei
MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI
MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK********GKGFGYGLFFENSATTNTLSARYYKDGS**
********PQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI
MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI
MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI
MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target101 DNA-methyltransferase MKpn2kI [Candidatus Liberibacter
319407456307 Cytosine-specific methyltransferase NlaX [Bartonella sp 1 2e-33
313667524313 cytosine-specific methyltransferase [Neisseria lactamic 1 4e-33
127471313 RecName: Full=Cytosine-specific methyltransferase NlaX; 1 2e-32
261400948313 modification methylase EcoRII [Neisseria lactamica ATCC 1 2e-32
315637499326 modification methylase EcoRII [Arcobacter butzleri JV22 1 1e-31
150026187335 type II modification methyltransferase [Flavobacterium 1 2e-31
119026301383 DNA-methyltransferase MKpn2kI [Bifidobacterium adolesce 1 9e-30
1657420379 DNA cytosine methyltransferase M.SenPI [Salmonella ente 1 2e-29
32470131379 DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae] L 1 2e-29
1871451379 C5-cytosine methylase [Salmonella enterica subsp. enter 1 2e-29
>gi|319407456|emb|CBI81106.1| Cytosine-specific methyltransferase NlaX [Bartonella sp. 1-1C] Length = 307 Back     alignment and organism information
 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFGVPQ RER+YI+ FL+ S  FKFP+P+ IK R+GDIL+  +D+K TISN LW G
Sbjct: 147 LKARDFGVPQNRERIYIVGFLDHSTNFKFPSPMNIKTRVGDILDNDVDEKYTISNTLWHG 206

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  NK+ GKGFGYGLF   S  TNTLSARYYKDGSEI
Sbjct: 207 HQRRKAQNKLNGKGFGYGLFNMESPYTNTLSARYYKDGSEI 247


Species: Bartonella sp. 1-1C
Genus: Bartonella
Family: Bartonellaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|313667524|ref|YP_004047808.1| cytosine-specific methyltransferase [Neisseria lactamica ST-640] Length = 313 Back     alignment and organism information
>gi|127471|sp|P24581|MTNX_NEILA RecName: Full=Cytosine-specific methyltransferase NlaX; Short=M.NlaX Length = 313 Back     alignment and organism information
>gi|261400948|ref|ZP_05987073.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970] Length = 313 Back     alignment and organism information
>gi|315637499|ref|ZP_07892709.1| modification methylase EcoRII [Arcobacter butzleri JV22] Length = 326 Back     alignment and organism information
>gi|150026187|ref|YP_001297013.1| type II modification methyltransferase [Flavobacterium psychrophilum JIP02/86] Length = 335 Back     alignment and organism information
>gi|119026301|ref|YP_910146.1| DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC 15703] Length = 383 Back     alignment and organism information
>gi|1657420|gb|AAC45971.1| DNA cytosine methyltransferase M.SenPI [Salmonella enterica subsp. enterica serovar Enteritidis] Length = 379 Back     alignment and organism information
>gi|32470131|ref|NP_863573.1| DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae] Length = 379 Back     alignment and organism information
>gi|1871451|dbj|BAA11167.1| C5-cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi] Length = 379 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target101 DNA-methyltransferase MKpn2kI [Candidatus Liberibacter
PRK10458467 PRK10458, PRK10458, DNA cytosine methylase; Provisional 2e-14
TIGR00675315 TIGR00675, dcm, DNA-methyltransferase (dcm) 2e-13
COG0270328 COG0270, Dcm, Site-specific DNA methylase [DNA replicat 2e-07
pfam00145319 pfam00145, DNA_methylase, C-5 cytosine-specific DNA met 8e-18
cd00315275 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA 4e-07
>gnl|CDD|182476 PRK10458, PRK10458, DNA cytosine methylase; Provisional Back     alignment and domain information
>gnl|CDD|161991 TIGR00675, dcm, DNA-methyltransferase (dcm) Back     alignment and domain information
>gnl|CDD|30619 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|143915 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase Back     alignment and domain information
>gnl|CDD|73191 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 101 DNA-methyltransferase MKpn2kI [Candidatus Liberibacter
PRK10458470 DNA cytosine methylase; Provisional 99.97
TIGR00675 425 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 99.81
pfam00145319 DNA_methylase C-5 cytosine-specific DNA methylase. 99.26
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylase 99.11
COG0270328 Dcm Site-specific DNA methylase [DNA replication, recom 99.03
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>TIGR00675 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>pfam00145 DNA_methylase C-5 cytosine-specific DNA methylase Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target101 DNA-methyltransferase MKpn2kI [Candidatus Liberibacter
3me5_A 482 Crystal Structure Of Putative Dna Cytosine Methylas 4e-21
3lx6_A410 Structure Of Probable Cytosine-Specific Methyltrans 1e-20
2i9k_A327 Engineered Extrahelical Base Destabilization Enhanc 1e-10
2z6u_A327 Ternary Structure Of The Glu119ala M.Hhai, C5-Cytos 1e-10
2zcj_A327 Ternary Structure Of The Glu119gln M.Hhai, C5-Cytos 1e-10
1mht_A327 Covalent Ternary Structure Of Hhai Methyltransferas 2e-10
2z6a_A327 S-Adenosyl-L-Methionine-Dependent Methyl Transfer: 2e-10
2uyh_A327 Hhai Dna Methyltransferase S87q-Q237s Mutant Comple 2e-10
1svu_A327 Structure Of The Q237w Mutant Of Hhai Dna Methyltra 3e-10
2uz4_A327 Hhai Dna Methyltransferase R165n Mutant Complex Wit 4e-09
2uyc_A327 Hhai Dna Methyltransferase R163n Mutant Complex Wit 4e-09
2z6q_A327 Ternary Structure Of Arg165ala M.Hhai C5-Cytosine D 6e-09
1dct_A324 Dna (Cytosine-5) Methylase From Haeiii Covalently B 1e-06
1fjx_A327 Structure Of Ternary Complex Of Hhai Methyltransfer 1e-09
>gi|294979850|pdb|3ME5|A Chain A, Crystal Structure Of Putative Dna Cytosine Methylase From Shigella Flexneri 2a Str. 301 Length = 482 Back     alignment and structure
 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 268 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPXVEAKYIL 326

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG  + N+    T TLSARYYKDG+EI
Sbjct: 327 TPVLWKYLYRYAKKHQARGNGFGYGXVYPNNPQSVTRTLSARYYKDGAEI 376


>gi|291463698|pdb|3LX6|A Chain A, Structure Of Probable Cytosine-Specific Methyltransferase From Shigella Flexneri Length = 410 Back     alignment and structure
>gi|118138268|pdb|2I9K|A Chain A, Engineered Extrahelical Base Destabilization Enhances Sequence Discrimination Of Dna Methyltransferase M.Hhai Length = 327 Back     alignment and structure
>gi|160877870|pdb|2Z6U|A Chain A, Ternary Structure Of The Glu119ala M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 Back     alignment and structure
>gi|161761159|pdb|2ZCJ|A Chain A, Ternary Structure Of The Glu119gln M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 Back     alignment and structure
gi|1065144|pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna And S-Adenosyl-L-Homocysteine Length = 327 Back     alignment and structure
>gi|159795737|pdb|2Z6A|A Chain A, S-Adenosyl-L-Methionine-Dependent Methyl Transfer: Observable Precatalytic Intermediates During Dna Cytosine Methylation Length = 327 Back     alignment and structure
>gi|189096062|pdb|2UYH|A Chain A, Hhai Dna Methyltransferase S87q-Q237s Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Back     alignment and structure
>gi|50513617|pdb|1SVU|A Chain A, Structure Of The Q237w Mutant Of Hhai Dna Methyltransferase: An Insight Into Protein-Protein Interactions Length = 327 Back     alignment and structure
>gi|189339547|pdb|2UZ4|A Chain A, Hhai Dna Methyltransferase R165n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Back     alignment and structure
>gi|189096047|pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Back     alignment and structure
>gi|158431504|pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna Methyltransferase With Unmodified Dna And Adohcy Length = 327 Back     alignment and structure
>gi|1127162|pdb|1DCT|A Chain A, Dna (Cytosine-5) Methylase From Haeiii Covalently Bound To Dna Length = 324 Back     alignment and structure
>gi|12084381|pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase Mutant (T250g) In Complex With Dna And Adohcy Length = 327 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target101 DNA-methyltransferase MKpn2kI [Candidatus Liberibacter
3me5_A 482 Cytosine-specific methyltransferase; structural genomic 1e-09
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482 Back     alignment and structure
 Score = 56.8 bits (136), Expect = 1e-09
 Identities = 35/108 (32%), Positives = 54/108 (50%), Gaps = 9/108 (8%)

Query: 3   ACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHIDD----KSTISN 55
                +PQ RER+ ++ F   LN   +F         P     L + +D     K  ++ 
Sbjct: 269 DGKHFLPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTP 328

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
            LW+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 VLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 376


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 DNA-methyltransferase MKpn2kI [Candidatus Liberibacter
3me5_A 482 Cytosine-specific methyltransferase; structural genomic 99.74
2c7p_A327 Modification methylase HHAI; DNA methyltransferase, met 99.2
1dct_A324 Protein (modification methylase HAEIII); enzyme, cytosi 99.11
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, NAD-b 98.91
1g55_A343 DNA cytosine methyltransferase DNMT2; human DNA methylt 98.89
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unme 97.6
2qrv_B230 DNA (cytosine-5)-methyltransferase 3-like; DNA methyltr 96.64
2qrv_A295 DNA (cytosine-5)-methyltransferase 3A; DNA methyltransf 94.66
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
Probab=99.74  E-value=3.1e-18  Score=123.61  Aligned_cols=99  Identities=32%  Similarity=0.592  Sum_probs=82.6

Q ss_pred             HHHCCCCCCCCEEEEEEEECCCC-CCCC--CCC----CCCCCCHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             34357973762799999847888-7558--887----7777784453125677432346889988997876555320135
Q gi|255764504|r    3 ACDFGVPQRRERLYIIDFLNPSV-EFKF--PTP----LGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGF   75 (101)
Q Consensus         3 a~dfGvPQ~ReRvfiVg~~~~~~-~f~~--P~~----~~~~~~l~diL~~~vd~k~~ls~~~~~~l~~~~~~~k~~g~GF   75 (101)
                      +++|||||+|+|+||||++++.. .+.|  ++.    ........++|++.++.++++++.+|.++.++..++..++++|
T Consensus       269 ~a~yGVPQ~R~RvfiVG~r~dl~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  348 (482)
T 3me5_A          269 DGKHFLPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPVLWKYLYRYAKKHQARGNGF  348 (482)
T ss_dssp             EGGGTSSBCCEEEEEEEEEGGGCCCTTCCGGGGGGGSCSSCCCTGGGSCSSCCGGGBCCHHHHHHHHHHHHC--------
T ss_pred             CCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             01137996677405884435767666767666554576533332223574112223567113456777877644205776


Q ss_pred             CCEEECCCC--CCCCCEEECCCCCCCCC
Q ss_conf             520434887--75033010403587639
Q gi|255764504|r   76 GYGLFFENS--ATTNTLSARYYKDGSEI  101 (101)
Q Consensus        76 g~~~~~~~~--~~~~Ti~arY~Kdg~e~  101 (101)
                      ++.++.++.  .+++|+++||+|||+++
T Consensus       349 ~~~~~~~~~~~~~~~t~~~r~~k~~~~~  376 (482)
T 3me5_A          349 GYGMVYPNNPQSVTRTLSARYYKDGAEI  376 (482)
T ss_dssp             --CEECTTSGGGGTCCBCCC---CCSSS
T ss_pred             CCCEECCCCCCCCCCCCCCEECCCCCCC
T ss_conf             7530037885344621033113799753



>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural genomics, protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 DNA-methyltransferase MKpn2kI [Candidatus Liberibacter
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 72 99.28
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197 99.13
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 98.97
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: C5 cytosine-specific DNA methylase, DCM
domain: DNA methylase HhaI
species: Haemophilus haemolyticus [TaxId: 726]
Probab=99.28  E-value=2.1e-13  Score=94.65  Aligned_cols=55  Identities=33%  Similarity=0.680  Sum_probs=47.4

Q ss_pred             CCHHHCCCCCCCCEEEEEEEECCC--CCCCCCCCCCCCCCHHHHHCCCCCCCCCCCH
Q ss_conf             983435797376279999984788--8755888777777844531256774323468
Q gi|255764504|r    1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISN   55 (101)
Q Consensus         1 Lna~dfGvPQ~ReRvfiVg~~~~~--~~f~~P~~~~~~~~l~diL~~~vd~k~~ls~   55 (101)
                      |||+||||||+|+|+||||++++.  ..+.||++......++|+|++..+.++.+.+
T Consensus       152 l~a~~~GvPQ~R~R~fivg~r~~~~~~~~~~p~p~~~~~~i~d~l~~~~~~~~~~~~  208 (327)
T d2c7pa1         152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVID  208 (327)
T ss_dssp             EEGGGGTCSBCCEEEEEEEEBGGGCCCCCCCCCCCCCCCCGGGTCCCGGGTGGGEEC
T ss_pred             ECHHHCCCCCHHHHHEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCC
T ss_conf             238980898465443253123675533112222223454333311346412331134



>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 101 DNA-methyltransferase MKpn2kI [Candidatus Liberiba
2c7p_A_1-192_307-327213 (A:1-192,A:307-327) Modification methylase HHAI; D 1e-05
3g7u_A_1-188_352-376213 (A:1-188,A:352-376) Cytosine-specific methyltransf 2e-05
1g55_A_1-202_296-343250 (A:1-202,A:296-343) DNA cytosine methyltransferase 4e-05
2qrv_A_1-192_277-295211 (A:1-192,A:277-295) DNA (cytosine-5)-methyltransfe 0.001
2pv0_B_182-386205 (B:182-386) DNA (cytosine-5)-methyltransferase 3-l 1e-05
>2c7p_A (A:1-192,A:307-327) Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus}Length = 213 Back     alignment and structure
 Score = 43.3 bits (101), Expect = 1e-05
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPR 38
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTF 191


>3g7u_A (A:1-188,A:352-376) Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural genomics, protein structure initiative, PSI; 1.75A {Escherichia coli O157}Length = 213 Back     alignment and structure
>1g55_A (A:1-202,A:296-343) DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens}Length = 250 Back     alignment and structure
>2qrv_A (A:1-192,A:277-295) DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens}Length = 211 Back     alignment and structure
>2pv0_B (B:182-386) DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B*Length = 205 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target101 DNA-methyltransferase MKpn2kI [Candidatus Liberibacter
2c7p_A_1-192_307-327213 Modification methylase HHAI; DNA methyltransferase 98.87
1g55_A_1-202_296-343250 DNA cytosine methyltransferase DNMT2; human DNA me 98.74
3g7u_A_1-188_352-376213 Cytosine-specific methyltransferase; DNA-binding, 98.4
2pv0_B_182-386205 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 98.3
1dct_A_324 Protein (modification methylase HAEIII); enzyme, c 98.18
2qrv_A_1-192_277-295211 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 97.8
2c7p_A_193-27482 Modification methylase HHAI; DNA methyltransferase 98.03
>2c7p_A (A:1-192,A:307-327) Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} Back     alignment and structure
Probab=98.87  E-value=1.4e-09  Score=75.16  Aligned_cols=44  Identities=39%  Similarity=0.812  Sum_probs=36.6

Q ss_pred             CCHHHCCCCCCCCEEEEEEEECCC--CCCCCCCCCCCC-CCHHHHHC
Q ss_conf             983435797376279999984788--875588877777-78445312
Q gi|255764504|r    1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIK-PRLGDILE   44 (101)
Q Consensus         1 Lna~dfGvPQ~ReRvfiVg~~~~~--~~f~~P~~~~~~-~~l~diL~   44 (101)
                      |||++||+||+|+|+|+||++++.  ..|.||+|.+.. .++-++|.
T Consensus       152 l~a~~~G~PQ~R~R~flva~r~~~~~~~~~~p~P~~~~~~~~~~~~~  198 (213)
T 2c7p_A          152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVVINVLQ  198 (213)
T ss_dssp             EEGGGGTCSBCCEEEEEEEEBGGGCCCCCCCCCCCCCCCCGCHHHHH
T ss_pred             ECHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             22899398616655621122367553311221222356534799999



>1g55_A (A:1-202,A:296-343) DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} Back     alignment and structure
>3g7u_A (A:1-188,A:352-376) Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural genomics, protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>2pv0_B (B:182-386) DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>1dct_A (A:) Protein (modification methylase HAEIII); enzyme, cytosine methylase; HET: DNA C49 5CM; 2.80A {Haemophilus aegyptus} Back     alignment and structure
>2qrv_A (A:1-192,A:277-295) DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>2c7p_A (A:193-274) Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} Back     alignment and structure