255764508

255764508

hypothetical protein CLIBASIA_04245

GeneID in NCBI database:8209972Locus tag:CLIBASIA_04245
Protein GI in NCBI database:255764508Protein Accession:YP_003065363.2
Gene range:-(944842, 945570)Protein Length:242aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGNR
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHccccHHHEEEccccccHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccHHHHHHHHHHHHccccHHHHEEccccccHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHcccccccccccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccc
MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLqfsyqrpllspqwkkdgniIVLLgngttiiptipairiepsfqSYSRIFETMRLYKSckqhsmhctiiisggdpqkhglAESIVYNNKllesgverddiKLETQSldtfqnaqFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSiiplsanfYLTELALKEYIGILIAYYRGNR
MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTiiptipairiepsFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGNR
MLLSWIFLIVSYWHLLCQSIRKiffmscfmllfsfiGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGttiiptipairiepSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGNR
MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGNR
MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGNR
MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN*
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGNR
MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGNR
MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGNR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target242 hypothetical protein CLIBASIA_04245 [Candidatus Liberib
33599364251 hypothetical protein BB0375 [Bordetella bronchiseptica 1 3e-41
33595083251 hypothetical protein BPP0372 [Bordetella parapertussis 1 1e-39
148975915253 hypothetical protein VSWAT3_06376 [Vibrionales bacteriu 1 4e-39
218709695253 hypothetical protein VS_1706 [Vibrio splendidus LGP32] 1 4e-39
149909508257 hypothetical protein PE36_16920 [Moritella sp. PE36] Le 1 4e-39
84387309253 hypothetical protein V12B01_04678 [Vibrio splendidus 12 1 1e-38
21242461253 hypothetical protein XAC1712 [Xanthomonas axonopodis pv 1 2e-38
294626655252 conserved hypothetical protein [Xanthomonas fuscans sub 1 2e-38
325924933253 hypothetical protein XPE_0280 [Xanthomonas perforans 91 1 5e-38
78047302252 hypothetical protein XCV1746 [Xanthomonas campestris pv 1 5e-38
>gi|33599364|ref|NP_886924.1| hypothetical protein BB0375 [Bordetella bronchiseptica RB50] Length = 251 Back     alignment and organism information
 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 93/223 (41%), Positives = 136/223 (60%), Gaps = 10/223 (4%)

Query: 13  WHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVL 71
           W    ++ R ++ +S  ++LF  +G G I   LL  LQ  YQ +P ++  W +  N IVL
Sbjct: 18  WRQWRRASRMLYGLS--LVLFLALGCGPIAAWLLDGLQSDYQAKPPIA--WGQR-NAIVL 72

Query: 72  LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES 131
           LG GT       A RIEP   SY+RI E  R Y  C++ +  C +I+SGGD   HG AE+
Sbjct: 73  LGAGTEQA----AGRIEPGIFSYARIVEAARRYHDCRKAAAQCKLIVSGGDAAYHGDAEA 128

Query: 132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
            VY + L+  GV+  D+  E  S++T+QNAQF+S++++      ++LVSS  HLKRS LY
Sbjct: 129 NVYRDPLVALGVDAADVLPEPGSMNTWQNAQFTSAVLRRYDADRVVLVSSGIHLKRSALY 188

Query: 192 FQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           F HFG+      +DYL+A +S++PLS NF + + AL EY+GI+
Sbjct: 189 FAHFGVAATPVRADYLHARWSVVPLSYNFAVADFALHEYLGIV 231


Species: Bordetella bronchiseptica
Genus: Bordetella
Family: Alcaligenaceae
Order: Burkholderiales
Class: Betaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|33595083|ref|NP_882726.1| hypothetical protein BPP0372 [Bordetella parapertussis 12822] Length = 251 Back     alignment and organism information
>gi|148975915|ref|ZP_01812704.1| hypothetical protein VSWAT3_06376 [Vibrionales bacterium SWAT-3] Length = 253 Back     alignment and organism information
>gi|218709695|ref|YP_002417316.1| hypothetical protein VS_1706 [Vibrio splendidus LGP32] Length = 253 Back     alignment and organism information
>gi|149909508|ref|ZP_01898162.1| hypothetical protein PE36_16920 [Moritella sp. PE36] Length = 257 Back     alignment and organism information
>gi|84387309|ref|ZP_00990329.1| hypothetical protein V12B01_04678 [Vibrio splendidus 12B01] Length = 253 Back     alignment and organism information
>gi|21242461|ref|NP_642043.1| hypothetical protein XAC1712 [Xanthomonas axonopodis pv. citri str. 306] Length = 253 Back     alignment and organism information
>gi|294626655|ref|ZP_06705252.1| conserved hypothetical protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122] Length = 252 Back     alignment and organism information
>gi|325924933|ref|ZP_08186362.1| hypothetical protein XPE_0280 [Xanthomonas perforans 91-118] Length = 253 Back     alignment and organism information
>gi|78047302|ref|YP_363477.1| hypothetical protein XCV1746 [Xanthomonas campestris pv. vesicatoria str. 85-10] Length = 252 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target242 hypothetical protein CLIBASIA_04245 [Candidatus Liberib
pfam02698148 pfam02698, DUF218, DUF218 domain 5e-25
PRK10494259 PRK10494, PRK10494, hypothetical protein; Provisional 2e-05
cd06259150 cd06259, YdcF-like, YdcF-like 3e-25
COG1434223 COG1434, COG1434, Uncharacterized conserved protein [Fu 7e-17
>gnl|CDD|145708 pfam02698, DUF218, DUF218 domain Back     alignment and domain information
>gnl|CDD|182497 PRK10494, PRK10494, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|99750 cd06259, YdcF-like, YdcF-like Back     alignment and domain information
>gnl|CDD|31623 COG1434, COG1434, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 242 hypothetical protein CLIBASIA_04245 [Candidatus Liberib
PRK10494259 hypothetical protein; Provisional 100.0
COG1434223 Uncharacterized conserved protein [Function unknown] 99.96
pfam02698148 DUF218 DUF218 domain. This large family of proteins con 100.0
cd06259150 YdcF-like YdcF-like. YdcF-like is a large family of mai 99.97
PRK10834239 hypothetical protein; Provisional 99.93
COG2949235 SanA Uncharacterized membrane protein [Function unknown 99.85
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase 97.0
KOG4533317 consensus 95.75
>PRK10494 hypothetical protein; Provisional Back     alignment and domain information
>COG1434 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam02698 DUF218 DUF218 domain Back     alignment and domain information
>cd06259 YdcF-like YdcF-like Back     alignment and domain information
>PRK10834 hypothetical protein; Provisional Back     alignment and domain information
>COG2949 SanA Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>KOG4533 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target242 hypothetical protein CLIBASIA_04245 [Candidatus Liberib
3ca8_A266 Protein YDCF; two domains, alpha/beta fold, helix bundl 7e-13
>3ca8_A Protein YDCF; two domains, alpha/beta fold, helix bundle, structural genomics, structure 2 function project, S2F, unknown function; 1.80A {Escherichia coli K12} Length = 266 Back     alignment and structure
 Score = 69.2 bits (169), Expect = 7e-13
 Identities = 22/156 (14%), Positives = 55/156 (35%), Gaps = 14/156 (8%)

Query: 55  RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRL----YKSCKQH 110
           +   S +     + ++L GN   ++P      I+ + +        + +      S    
Sbjct: 26  QDDFSGEVPYQADCVILAGNA--VMP-----TIDAACKIARDQQIPLLISGGIGHSTTFL 78

Query: 111 SMHCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIK 169
                        +  G AE+ +  +   +   +  + I +E QS +  +NA+FS +++ 
Sbjct: 79  YSAIAQHPHYNTIRTTGRAEATILADIAHQFWHIPHEKIWIEDQSTNCGENARFSIALLN 138

Query: 170 NM--QGKNIILVSSAYHLKRSQLYFQHFGINTKASC 203
               +    I+V      +R+   F+    +   + 
Sbjct: 139 QAVERVHTAIVVQDPTMQRRTMATFRRMTGDNPDAP 174


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target242 hypothetical protein CLIBASIA_04245 [Candidatus Liberib
3ca8_A266 Protein YDCF; two domains, alpha/beta fold, helix bundl 99.93
>3ca8_A Protein YDCF; two domains, alpha/beta fold, helix bundle, structural genomics, structure 2 function project, S2F, unknown function; 1.80A {Escherichia coli K12} Back     alignment and structure
Probab=99.93  E-value=5.6e-25  Score=180.85  Aligned_cols=114  Identities=20%  Similarity=0.305  Sum_probs=98.9

Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEECCCCC-----------------
Q ss_conf             545687589996252137777655543468205899999999998252005753389706888-----------------
Q gi|255764508|r   61 QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP-----------------  123 (242)
Q Consensus        61 ~~~~~~d~IVVLGgG~~~~~~~~~~~~~~~~~~~~Rl~~a~~L~~~~~~~~~~~~ii~SGg~~-----------------  123 (242)
                      ..+.++|+||||||+.                 ..|...|++||+++.+     ++++|||.+                 
T Consensus        32 ~~p~~aD~IVvlG~~~-----------------l~~~~~A~~L~~~g~a-----~liisGG~G~~T~~l~~~i~~~~~~~   89 (266)
T 3ca8_A           32 EVPYQADCVILAGNAV-----------------MPTIDAACKIARDQQI-----PLLISGGIGHSTTFLYSAIAQHPHYN   89 (266)
T ss_dssp             TCCCCCSEEEEESCCC-----------------HHHHHHHHHHHHHHTC-----CEEEECCSSTTHHHHHHHHHTCTTGG
T ss_pred             CCCCCCCEEEECCCCC-----------------HHHHHHHHHHHHCCCC-----CEEEECCCCCCCHHHHHHHHCCCCCC
T ss_conf             7888999899889982-----------------1899999999980599-----88973698755314565543065445


Q ss_pred             --CCCCCCHHHHHHHHHHHC-CCCHHHHHCCHHHHHHHHHHHHHHHHHHHCC--CCCEEEECCHHHHHHHHHHHHHCC
Q ss_conf             --877888279999999974-9998781111014665777999999976236--864088534588999999999769
Q gi|255764508|r  124 --QKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQ--GKNIILVSSAYHLKRSQLYFQHFG  196 (242)
Q Consensus       124 --~~~~~~Ea~~m~~~l~~~-Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~--~~~vilVTsa~Hm~RA~~~f~~~g  196 (242)
                        ...+.+||+.|++++.+. |||+++|++|++|+||.|||.++++++++++  +++++||||+|||+||.+.|+++-
T Consensus        90 ~i~~~g~sEAe~~a~~a~~~~GVp~~~Il~E~~S~NT~eNa~~s~~lL~~~~~~~~siilV~~p~h~rRa~atf~k~~  167 (266)
T 3ca8_A           90 TIRTTGRAEATILADIAHQFWHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQRRTMATFRRMT  167 (266)
T ss_dssp             GSCCTTSCHHHHHHHHHHHTTCCCGGGEEEECCCCSHHHHHHHHHHHHHTCSSCCSCEEEECCTTTHHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCCCHHHEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHC
T ss_conf             567789889999999999974999999664677777899999999999963999877999898899999999999974




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 242 hypothetical protein CLIBASIA_04245 [Candidatus Li
3ca8_A_32-182151 (A:32-182) Protein YDCF; two domains, alpha/beta f 8e-18
>3ca8_A (A:32-182) Protein YDCF; two domains, alpha/beta fold, helix bundle, structural genomics, structure 2 function project, S2F, unknown function; 1.80A {Escherichia coli K12}Length = 151 Back     alignment and structure
 Score = 85.1 bits (210), Expect = 8e-18
 Identities = 24/146 (16%), Positives = 55/146 (37%), Gaps = 8/146 (5%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           ++L GN   ++PTI A   + +      +  +  +  S                 +  G 
Sbjct: 9   VILAGNA--VMPTIDAA-CKIARDQQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRTTGR 65

Query: 129 AESIVYNNKLLE-SGVERDDIKLETQSLDTFQNAQFSSSMIK--NMQGKNIILVSSAYHL 185
           AE+ +  +   +   +  + I +E QS +  +NA+FS +++     +    I+V      
Sbjct: 66  AEATILADIAHQFWHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQ 125

Query: 186 KRSQLYFQHFGINTKASCSDYLNAYY 211
           +R+   F+    +   +      +Y 
Sbjct: 126 RRTMATFRRMTGDNPDAPRWL--SYP 149


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target242 hypothetical protein CLIBASIA_04245 [Candidatus Liberib
3ca8_A_32-182151 Protein YDCF; two domains, alpha/beta fold, helix 99.95
3d8u_A_103-223121 PURR transcriptional regulator; APC91343.1, vibrio 91.46
3egc_A_109-240132 Putative ribose operon repressor; structural genom 90.56
3kjx_A_169-300132 Transcriptional regulator, LACI family; LACL famil 90.43
3gv0_A_111-242132 Transcriptional regulator, LACI family; transcript 90.28
>3ca8_A (A:32-182) Protein YDCF; two domains, alpha/beta fold, helix bundle, structural genomics, structure 2 function project, S2F, unknown function; 1.80A {Escherichia coli K12} Back     alignment and structure
Probab=99.95  E-value=6.6e-28  Score=200.88  Aligned_cols=124  Identities=17%  Similarity=0.213  Sum_probs=107.5

Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEECCC------------------C
Q ss_conf             5456875899962521377776555434682058999999999982520057533897068------------------8
Q gi|255764508|r   61 QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG------------------D  122 (242)
Q Consensus        61 ~~~~~~d~IVVLGgG~~~~~~~~~~~~~~~~~~~~Rl~~a~~L~~~~~~~~~~~~ii~SGg------------------~  122 (242)
                      ++++++|+|||||||..                 .|...|+++|+++.++.    ++++|+                  .
T Consensus         1 d~~~~~d~ivVLG~~~~-----------------~r~~~a~~l~~~~~a~~----i~~~g~~~~~~~~~~~~~~~~~~~~   59 (151)
T 3ca8_A            1 EVPYQADCVILAGNAVM-----------------PTIDAACKIARDQQIPL----LISGGIGHSTTFLYSAIAQHPHYNT   59 (151)
T ss_dssp             TCCCCCSEEEEESCCCH-----------------HHHHHHHHHHHHHTCCE----EEECCSSTTHHHHHHHHHTCTTGGG
T ss_pred             CCCCCCCEEEEECCCCH-----------------HHHHHHHHHHHHCCCCE----EEECCCCCCCCHHHHHHHCCCCCCC
T ss_conf             77889898998189841-----------------88999999998359888----9617987454104444312666666


Q ss_pred             CCCCCCCHHHHHHHHHHHC-CCCHHHHHCCHHHHHHHHHHHHHHHHHHHC--CCCCEEEECCHHHHHHHHHHHHHCCCEE
Q ss_conf             8877888279999999974-999878111101466577799999997623--6864088534588999999999769818
Q gi|255764508|r  123 PQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNIILVSSAYHLKRSQLYFQHFGINT  199 (242)
Q Consensus       123 ~~~~~~~Ea~~m~~~l~~~-Gv~~~~I~~e~~s~nT~ena~~~~~il~~~--~~~~vilVTsa~Hm~RA~~~f~~~gi~~  199 (242)
                      ..+++.+||+.|+++|+++ |||+++|++|++|+||+||+.+++++++++  ++++++||||+|||+||+++|+++|+++
T Consensus        60 ~~~~~~sEA~~m~~~l~~~~Gvp~~~I~~e~~s~~T~eNa~~~~~~l~~~~~~~~~iilVTs~~H~~Ra~~~~~~~~~~~  139 (151)
T 3ca8_A           60 IRTTGRAEATILADIAHQFWHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQRRTMATFRRMTGDN  139 (151)
T ss_dssp             SCCTTSCHHHHHHHHHHHTTCCCGGGEEEECCCCSHHHHHHHHHHHHHTCSSCCSCEEEECCTTTHHHHHHHHHHHHCCC
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCHHHEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHCCCC
T ss_conf             78899889999999999964998999552788778899999999999963999887999898888999999999975767


Q ss_pred             EEEECC
Q ss_conf             998426
Q gi|255764508|r  200 KASCSD  205 (242)
Q Consensus       200 ~p~~~d  205 (242)
                      .|+|++
T Consensus       140 ~~~~~~  145 (151)
T 3ca8_A          140 PDAPRW  145 (151)
T ss_dssp             TTSCSE
T ss_pred             CCCCCE
T ss_conf             777402



>3d8u_A (A:103-223) PURR transcriptional regulator; APC91343.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>3egc_A (A:109-240) Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcription, transcription regulation; 2.35A {Burkholderia thailandensis E264} Back     alignment and structure
>3kjx_A (A:169-300) Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3gv0_A (A:111-242) Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics, protein structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure