255764510

255764510

uroporphyrinogen-III synthase

GeneID in NCBI database:8210058Locus tag:CLIBASIA_04685
Protein GI in NCBI database:255764510Protein Accession:YP_003065448.2
Gene range:-(1039074, 1039772)Protein Length:232aa
Gene description:uroporphyrinogen-III synthase
COG prediction:[H] Uroporphyrinogen-III synthase
KEGG prediction:hemD; uroporphyrinogen-III synthase (EC:4.2.1.75); K01719 uroporphyrinogen-III synthase [EC:4.2.1.75]
SEED prediction:Uroporphyrinogen-III synthase (EC 4.2.1.75)
Pathway involved in KEGG:Porphyrin and chlorophyll metabolism [PATH:las00860]
Subsystem involved in SEED:Heme and Siroheme Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLYFFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPLRR
cEEEEEccHHHHHHHHHHHHHccccEEEEEEEEEEEccccccccccccccEEEEEcHHHHHHHHHcccccccEEEEcHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHccccEEEEEcHHHHHHHHHHHccccccEEEEEccHHHHHHHHHccccEEEEcccccHHHHHHHHcccc
cEEEEEcccccHHHHHHHHHHcccEEEEEccccccccccHHcccccccccEEEEEcHHHHHHHHHHccccccEEEEcHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHcccEEEEEEEEEcccccccHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHccccEEEEcccccHHHHHHHccccc
MYIVITRPIKKALRTQEKIQkmgyipvmmplsyfiHDRESVFLAMQQSYGAIaitsseslstlpanfcrhtpifaIGEASACLArqkgftqifhgkdnsINLAKIIVEQKvlftpqkpliylggkprnfhfedyliehkiplrvidcyysqdiaypETTMKNLLQNADAILFYARSSVLYFFSLPLPAKISAAFLCLSNniasaipasyknvvtvacfpketsllkllplrr
myivitrpikkalrtqekiqkmgyIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLYFFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPketsllkllplrr
MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLYFFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPLRR
MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLYFFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPL**
MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLYFFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPLRR
MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLYFFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLYFFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPLRR
MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLYFFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPLRR
MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLYFFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPLRR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target232 uroporphyrinogen-III synthase [Candidatus Liberibacter
315122375209 uroporphyrinogen-III synthase [Candidatus Liberibacter 1 2e-69
222087477241 uroporphyrinogen-III synthase protein [Agrobacterium ra 1 4e-39
15889909246 uroporphyrinogen-III synthase [Agrobacterium tumefacien 1 2e-30
222150056238 uroporphyrinogen-III synthase [Agrobacterium vitis S4] 1 5e-30
325294022246 uroporphyrinogen-III synthase [Agrobacterium sp. H13-3] 1 6e-30
209551272235 uroporphyrinogen-III synthase [Rhizobium leguminosarum 1 1e-29
327188882264 uroporphyrinogen-III synthase protein [Rhizobium etli C 1 6e-29
218673005235 uroporphyrinogen-III synthase [Rhizobium etli GR56] Len 1 5e-27
86359486235 uroporphyrinogen-III synthase [Rhizobium etli CFN 42] L 1 2e-26
190893754235 uroporphyrinogen-III synthase [Rhizobium etli CIAT 652] 1 3e-26
>gi|315122375|ref|YP_004062864.1| uroporphyrinogen-III synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 209 Back     alignment and organism information
 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 158/193 (81%)

Query: 28  MMPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPIFAIGEASACLARQK 87
           MMPLSYF +DRE+V LA+Q+SYG IAITSSESLSTLP  FC ++ +F+IGEASA LAR K
Sbjct: 1   MMPLSYFTYDREAVSLALQESYGGIAITSSESLSTLPDKFCHNSILFSIGEASASLARTK 60

Query: 88  GFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDC 147
           GF+QIF GK+NSI+LA++IV++K LFTPQKPLIYLGGK R  HFE+YL +H+IP + IDC
Sbjct: 61  GFSQIFCGKNNSISLAQLIVQKKELFTPQKPLIYLGGKKRKIHFENYLFQHRIPFKTIDC 120

Query: 148 YYSQDIAYPETTMKNLLQNADAILFYARSSVLYFFSLPLPAKISAAFLCLSNNIASAIPA 207
           YYS +I Y +  ++ ++++ADA+LFYA SSV  FF LPLP KIS  FLCLS NIAS IP 
Sbjct: 121 YYSWNIVYSKKEVERIIKSADAVLFYASSSVSNFFLLPLPIKISVRFLCLSQNIASEIPV 180

Query: 208 SYKNVVTVACFPK 220
           S+ ++V+VA FPK
Sbjct: 181 SFTDLVSVAEFPK 193


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222087477|ref|YP_002546014.1| uroporphyrinogen-III synthase protein [Agrobacterium radiobacter K84] Length = 241 Back     alignment and organism information
>gi|15889909|ref|NP_355590.1| uroporphyrinogen-III synthase [Agrobacterium tumefaciens str. C58] Length = 246 Back     alignment and organism information
>gi|222150056|ref|YP_002551013.1| uroporphyrinogen-III synthase [Agrobacterium vitis S4] Length = 238 Back     alignment and organism information
>gi|325294022|ref|YP_004279886.1| uroporphyrinogen-III synthase [Agrobacterium sp. H13-3] Length = 246 Back     alignment and organism information
>gi|209551272|ref|YP_002283189.1| uroporphyrinogen-III synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 235 Back     alignment and organism information
>gi|327188882|gb|EGE56074.1| uroporphyrinogen-III synthase protein [Rhizobium etli CNPAF512] Length = 264 Back     alignment and organism information
>gi|218673005|ref|ZP_03522674.1| uroporphyrinogen-III synthase [Rhizobium etli GR56] Length = 235 Back     alignment and organism information
>gi|86359486|ref|YP_471378.1| uroporphyrinogen-III synthase [Rhizobium etli CFN 42] Length = 235 Back     alignment and organism information
>gi|190893754|ref|YP_001980296.1| uroporphyrinogen-III synthase [Rhizobium etli CIAT 652] Length = 235 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target232 uroporphyrinogen-III synthase [Candidatus Liberibacter
PRK09189240 PRK09189, PRK09189, uroporphyrinogen-III synthase; Vali 5e-47
cd06578239 cd06578, HemD, Uroporphyrinogen-III synthase (HemD) cat 8e-17
pfam02602229 pfam02602, HEM4, Uroporphyrinogen-III synthase HemD 7e-11
COG1587248 COG1587, HemD, Uroporphyrinogen-III synthase [Coenzyme 5e-17
PRK05928249 PRK05928, hemD, uroporphyrinogen-III synthase; Reviewed 4e-09
>gnl|CDD|169701 PRK09189, PRK09189, uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>gnl|CDD|119440 cd06578, HemD, Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme Back     alignment and domain information
>gnl|CDD|145641 pfam02602, HEM4, Uroporphyrinogen-III synthase HemD Back     alignment and domain information
>gnl|CDD|31775 COG1587, HemD, Uroporphyrinogen-III synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|180313 PRK05928, hemD, uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 232 uroporphyrinogen-III synthase [Candidatus Liberibacter
PRK09189237 uroporphyrinogen-III synthase; Validated 100.0
PRK05928252 hemD uroporphyrinogen-III synthase; Reviewed 100.0
PRK05752255 uroporphyrinogen-III synthase; Validated 100.0
cd06578239 HemD Uroporphyrinogen-III synthase (HemD) catalyzes the 100.0
COG1587248 HemD Uroporphyrinogen-III synthase [Coenzyme metabolism 100.0
PRK08811264 uroporphyrinogen-III synthase; Validated 100.0
pfam02602229 HEM4 Uroporphyrinogen-III synthase HemD. This family co 100.0
PRK06975 653 bifunctional uroporphyrinogen-III synthetase/uroporphyr 100.0
KOG4132260 consensus 99.97
PRK07239 381 bifunctional uroporphyrinogen-III synthetase/response r 99.89
PRK07168474 bifunctional uroporphyrinogen-III methyltransferase/uro 99.86
cd06299265 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding 92.91
cd06284267 PBP1_LacI_like_6 Ligand-binding domain of an uncharacte 92.38
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding domai 91.86
cd06270268 PBP1_GalS_like Ligand binding domain of DNA transcripti 90.07
PRK05928 252 hemD uroporphyrinogen-III synthase; Reviewed 99.35
COG1587 248 HemD Uroporphyrinogen-III synthase [Coenzyme metabolism 99.22
cd06578 239 HemD Uroporphyrinogen-III synthase (HemD) catalyzes the 99.21
PRK05752 255 uroporphyrinogen-III synthase; Validated 99.11
PRK09189 237 uroporphyrinogen-III synthase; Validated 99.1
pfam02602 229 HEM4 Uroporphyrinogen-III synthase HemD. This family co 99.01
PRK07168 474 bifunctional uroporphyrinogen-III methyltransferase/uro 98.9
PRK08811 264 uroporphyrinogen-III synthase; Validated 98.7
PRK06975 653 bifunctional uroporphyrinogen-III synthetase/uroporphyr 98.5
PRK07239381 bifunctional uroporphyrinogen-III synthetase/response r 98.19
KOG4132260 consensus 96.54
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 96.89
PRK00257 379 erythronate-4-phosphate dehydrogenase; Validated 96.02
PRK13243333 glyoxylate reductase; Reviewed 95.61
PRK13581 524 D-3-phosphoglycerate dehydrogenase; Provisional 95.03
cd06290265 PBP1_LacI_like_9 Ligand-binding domain of uncharacteriz 93.72
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 93.28
COG1609333 PurR Transcriptional regulators [Transcription] 92.33
cd01575268 PBP1_GntR Ligand-binding domain of DNA transcription re 90.98
cd06288269 PBP1_sucrose_transcription_regulator Ligand-binding dom 90.44
cd06277268 PBP1_LacI_like_1 Ligand-binding domain of uncharacteriz 90.18
pfam00389313 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenas 91.71
cd06291265 PBP1_Qymf_like Ligand binding domain of the lacI-like t 90.94
>PRK09189 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>PRK05928 hemD uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>PRK05752 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>cd06578 HemD Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme Back     alignment and domain information
>COG1587 HemD Uroporphyrinogen-III synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK08811 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>pfam02602 HEM4 Uroporphyrinogen-III synthase HemD Back     alignment and domain information
>PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>KOG4132 consensus Back     alignment and domain information
>PRK07239 bifunctional uroporphyrinogen-III synthetase/response regulator domain protein; Validated Back     alignment and domain information
>PRK07168 bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia Back     alignment and domain information
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>PRK05928 hemD uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>COG1587 HemD Uroporphyrinogen-III synthase [Coenzyme metabolism] Back     alignment and domain information
>cd06578 HemD Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme Back     alignment and domain information
>PRK05752 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>PRK09189 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>pfam02602 HEM4 Uroporphyrinogen-III synthase HemD Back     alignment and domain information
>PRK07168 bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>PRK08811 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>PRK07239 bifunctional uroporphyrinogen-III synthetase/response regulator domain protein; Validated Back     alignment and domain information
>KOG4132 consensus Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>pfam00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain Back     alignment and domain information
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target232 uroporphyrinogen-III synthase [Candidatus Liberibacter
1jr2_A286 Structure Of Uroporphyrinogen Iii Synthase Length = 1e-17
3mw8_A240 Crystal Structure Of An Uroporphyrinogen-Iii Syntha 5e-17
3p9z_A229 Crystal Structure Of Uroporphyrinogen-Iii Synthetas 7e-07
>gi|16974837|pdb|1JR2|A Chain A, Structure Of Uroporphyrinogen Iii Synthase Length = 286 Back     alignment and structure
 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/251 (12%), Positives = 71/251 (28%), Gaps = 27/251 (10%)

Query: 1   MYIVITR-PIKK---ALRTQEKIQKMGYIPVMMPLSYFIHDRESVF---LAMQQSYGAIA 53
           M +++ +   +          ++   G    ++P+  F       F   L+  + YG + 
Sbjct: 22  MKVLLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLPSFSEKLSHPEDYGGLI 81

Query: 54  ITSSESLSTLPANFCRHTPIFAIGEASACLARQKGFTQIFHGK-------------DNSI 100
            TS  ++        ++        +       K    + +               +   
Sbjct: 82  FTSPRAVEAAELCLEQNNKTEVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTEGETCG 141

Query: 101 NLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTM 160
           N  K+        +   PL++  G  +       L +  I +  I  Y +      +  +
Sbjct: 142 NAEKLAEYICSRESSALPLLFPCGNLKREILPKALKDKGIAMESITVYQTVAHPGIQGNL 201

Query: 161 KNLLQNADAI---LFYARS----SVLYFFSLPLPAKISAAFLCLSNNIASAIPASYKNVV 213
            +            F++ S    S+ +   L         F  +    A A+ A    V 
Sbjct: 202 NSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAIGPTTARALAAQGLPVS 261

Query: 214 TVACFPKETSL 224
             A  P   +L
Sbjct: 262 CTAESPTPQAL 272


>gi|296278592|pdb|3MW8|A Chain A, Crystal Structure Of An Uroporphyrinogen-Iii Synthase (Sama_ Shewanella Amazonensis Sb2b At 1.65 A Resolution Length = 240 Back     alignment and structure
>gi|310943011|pdb|3P9Z|A Chain A, Crystal Structure Of Uroporphyrinogen-Iii Synthetase From Helicobacter Pylori 26695 Length = 229 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target232 uroporphyrinogen-III synthase [Candidatus Liberibacter
3mw8_A240 Uroporphyrinogen-III synthase; structural genomics, joi 6e-18
1jr2_A286 Uroporphyrinogen-III synthase; heme biosynthesis, HEAM 8e-14
1wcw_A261 Uroporphyrinogen III synthase; congenital erythropoieti 3e-07
3d8t_A286 Uroporphyrinogen-III synthase; heme biosynthesis, lyase 2e-06
3p9z_A229 Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2, str 6e-10
>3mw8_A Uroporphyrinogen-III synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 1.65A {Shewanella amazonensis} Length = 240 Back     alignment and structure
 Score = 86.4 bits (213), Expect = 6e-18
 Identities = 33/240 (13%), Positives = 73/240 (30%), Gaps = 11/240 (4%)

Query: 1   MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRES-VFLAMQQSYGAIAITSSES 59
           M +++TRP  K       +  +    ++ PL        +   L        +   S+ +
Sbjct: 2   MKLLLTRPEGKNAAMASALDALAIPYLVEPLLSVEAAAVTQAQLDELSRADILIFISTSA 61

Query: 60  LSTLPANFCR---HTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQ 116
           +S               +A+G+A+A     +G T      D+      + +      + +
Sbjct: 62  VSFATPWLKDQWPKATYYAVGDATADALALQGITAERSPADSQATEGLLTLPSLEQVSGK 121

Query: 117 KPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNA--DAILFYA 174
           + +I  G   R     D L      +  ++ Y             +  Q+   D I+  +
Sbjct: 122 QIVIVRGKGGREAM-ADGLRLRGANVSYLEVYQRACPPLDAPASVSRWQSFGIDTIVVTS 180

Query: 175 RSSVLYFFSL----PLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPL 230
              +    +L              +  S  + +         VT A    + ++L  L +
Sbjct: 181 GEVLENLINLVPKDSFAWLRDCHIIVPSARVETQARKKGLRRVTNAGAANQAAVLDALGM 240


>1jr2_A Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens} SCOP: c.113.1.1 Length = 286 Back     alignment and structure
>1wcw_A Uroporphyrinogen III synthase; congenital erythropoietic porphyria, structural genomics, riken structural genomics/proteomics initiative; 1.30A {Thermus thermophilus} PDB: 1wd7_A 1wcx_A Length = 261 Back     alignment and structure
>3d8t_A Uroporphyrinogen-III synthase; heme biosynthesis, lyase; 1.60A {Thermus thermophilus} PDB: 3d8r_A 3d8s_A 3d8n_A Length = 286 Back     alignment and structure
>3p9z_A Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2, structural genomics, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.10A {Helicobacter pylori} Length = 229 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target232 uroporphyrinogen-III synthase [Candidatus Liberibacter
1jr2_A286 Uroporphyrinogen-III synthase; heme biosynthesis, HEAM 100.0
3mw8_A240 Uroporphyrinogen-III synthase; structural genomics, joi 100.0
3d8t_A286 Uroporphyrinogen-III synthase; heme biosynthesis, lyase 100.0
1wcw_A261 Uroporphyrinogen III synthase; congenital erythropoieti 100.0
3p9z_A229 Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2, str 100.0
3mw8_A 240 Uroporphyrinogen-III synthase; structural genomics, joi 99.13
3d8t_A 286 Uroporphyrinogen-III synthase; heme biosynthesis, lyase 99.12
1wcw_A 261 Uroporphyrinogen III synthase; congenital erythropoieti 99.08
1jr2_A 286 Uroporphyrinogen-III synthase; heme biosynthesis, HEAM 99.03
3p9z_A229 Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2, str 98.6
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural genomics 96.8
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; structura 96.56
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural genomi 96.29
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; allosteric re 96.11
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural genom 95.95
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreduct 95.71
3k9c_A289 Transcriptional regulator, LACI family protein; PSI-II, 95.71
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate-4-ph 95.44
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) 94.92
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; st 94.59
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD( 94.58
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seat 94.54
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydrogenas 93.12
3c3k_A285 Alanine racemase; structural genomics, protein structur 92.66
1o1y_A239 Conserved hypothetical protein TM1158; structural genom 90.2
>1jr2_A Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens} SCOP: c.113.1.1 Back     alignment and structure
Probab=100.00  E-value=4.9e-44  Score=282.24  Aligned_cols=227  Identities=16%  Similarity=0.205  Sum_probs=194.2

Q ss_pred             CEE-EEECCHHHH---HHHHHHHHHCCCCEEEECCEEEECCCCCC---CCCCCCCCCEEEEECHHHHHHHHHHH------
Q ss_conf             938-985896886---99999999879829994210000078520---01644758799984846799988620------
Q gi|255764510|r    1 MYI-VITRPIKKA---LRTQEKIQKMGYIPVMMPLSYFIHDRESV---FLAMQQSYGAIAITSSESLSTLPANF------   67 (232)
Q Consensus         1 M~i-litRp~~~a---~~~~~~L~~~G~~~i~~Pli~i~~~~~~~---~~~~~~~~d~iiftS~~av~~~~~~~------   67 (232)
                      ||| |++||.++.   +.+...|+++|++++.+|+|+|+|.+.+.   .+.++.+||||||||+|||++|+..+      
T Consensus        22 ~~vlll~~~~~~~~~~d~~~~~L~~~G~~~~~~Pli~i~~~~~~~l~~~~~~l~~y~~iIFTS~naV~~f~~~l~~~~~~  101 (286)
T 1jr2_A           22 MKVLLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLPSFSEKLSHPEDYGGLIFTSPRAVEAAELCLEQNNKT  101 (286)
T ss_dssp             CEEEEEESSCCCBTTBCHHHHHHHTTTCEEEEEECEEEEECCHHHHHHHHTCGGGCSEEEECCHHHHHHHHHHHHHTTCH
T ss_pred             CEEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCEEEEECCHHHHHHHHHCHHHCCEEEEECHHHHHHHHHHHHHHCCC
T ss_conf             08999778987666548999999988997899899888838758999987283115789997869999999999873664


Q ss_pred             ----------CCCCCEECCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHH
Q ss_conf             ----------0136300041589999764101223544454567899986422012777538972156756201468984
Q gi|255764510|r   68 ----------CRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIE  137 (232)
Q Consensus        68 ----------~~~~~~~~vg~~t~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~vl~~~g~~~~~~l~~~L~~  137 (232)
                                +...+++|+|++|++++++.|+....+..++++.+.+++...   ...+++++++||+.++++|.+.|++
T Consensus       102 ~~~~~~l~~~~~~~~i~aVG~~Ta~~L~~~G~~~~~~~~~~ae~L~~~i~~~---~~~~~~iL~~~g~~~~~~L~~~L~~  178 (286)
T 1jr2_A          102 EVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTEGETCGNAEKLAEYICSR---ESSALPLLFPCGNLKREILPKALKD  178 (286)
T ss_dssp             HHHHHHTHHHHHHSEEEECSHHHHHHHHHTTCCCSCCSCSSHHHHHHHHHTS---CCCSSCEEEEESCGGGCCHHHHHHT
T ss_pred             CHHHHHHHHHCCCCEEEEECHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHH---CCCCCEEEEEECCCCHHHHHHHHHH
T ss_conf             0124555430147859998779999999869910067888999999999875---2689759986056650789999984


Q ss_pred             CCCEEEEEEEEEECCCCCCHHHHHHHH---CCCCEEEEECHHHHHHHHHHCCHHH----CCEEEEECCHHHHHHHHHCCC
Q ss_conf             698256768875046899988999862---3783899807899999997135440----580399718899999997699
Q gi|255764510|r  138 HKIPLRVIDCYYSQDIAYPETTMKNLL---QNADAILFYARSSVLYFFSLPLPAK----ISAAFLCLSNNIASAIPASYK  210 (232)
Q Consensus       138 ~g~~v~~~~vY~~~~~~~~~~~~~~~~---~~~d~i~f~S~~~v~~~~~~~~~~~----~~~~~~~ig~~tA~~~~~~g~  210 (232)
                      .|+.|+++++|++++.+...+.+...+   +.+|+|+||||++|+.|++++....    .+++++|||++||+++++.|+
T Consensus       179 ~G~~v~~~~vY~t~~~~~~~~~~~~~l~~~~~~d~VvFtSps~v~~f~~~l~~~~~~~~~~~~i~aIG~~Ta~~l~~~G~  258 (286)
T 1jr2_A          179 KGIAMESITVYQTVAHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAIGPTTARALAAQGL  258 (286)
T ss_dssp             TTCCEEEEECEEEEECTTHHHHHHHHHHHHCSCSEEEESSHHHHHHHHHHHHHHHGGGGGGSEEEESSHHHHHHHHHTTC
T ss_pred             CCCEEEEEEEEEEECCCCCHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCCCEEEEECHHHHHHHHHCCC
T ss_conf             79855699887221487421889999873268729999398999999999987303243681899989999999998699


Q ss_pred             CEEEECCCCCHHHHHHHHHH
Q ss_conf             66998799998899999861
Q gi|255764510|r  211 NVVTVACFPKETSLLKLLPL  230 (232)
Q Consensus       211 ~~~~va~~p~~~~ll~al~~  230 (232)
                      +++++|+.|+.++|+++|.+
T Consensus       259 ~~~iva~~pt~e~Ll~aI~~  278 (286)
T 1jr2_A          259 PVSCTAESPTPQALATGIRK  278 (286)
T ss_dssp             CCSEECSSSSHHHHHHHHHH
T ss_pred             CCEEEECCCCHHHHHHHHHH
T ss_conf             73799797897999999999



>3mw8_A Uroporphyrinogen-III synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 1.65A {Shewanella amazonensis} Back     alignment and structure
>3d8t_A Uroporphyrinogen-III synthase; heme biosynthesis, lyase; 1.60A {Thermus thermophilus} PDB: 3d8r_A 3d8s_A 3d8n_A Back     alignment and structure
>1wcw_A Uroporphyrinogen III synthase; congenital erythropoietic porphyria, structural genomics, riken structural genomics/proteomics initiative; 1.30A {Thermus thermophilus} PDB: 1wd7_A 1wcx_A Back     alignment and structure
>3p9z_A Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2, structural genomics, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.10A {Helicobacter pylori} Back     alignment and structure
>3mw8_A Uroporphyrinogen-III synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 1.65A {Shewanella amazonensis} Back     alignment and structure
>3d8t_A Uroporphyrinogen-III synthase; heme biosynthesis, lyase; 1.60A {Thermus thermophilus} PDB: 3d8r_A 3d8s_A 3d8n_A Back     alignment and structure
>1wcw_A Uroporphyrinogen III synthase; congenital erythropoietic porphyria, structural genomics, riken structural genomics/proteomics initiative; 1.30A {Thermus thermophilus} PDB: 1wd7_A 1wcx_A Back     alignment and structure
>1jr2_A Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens} SCOP: c.113.1.1 Back     alignment and structure
>3p9z_A Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2, structural genomics, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.10A {Helicobacter pylori} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus HB8} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, protein structure initiative; 2.14A {Rhodococcus jostii RHA1} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosphate ION, oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substrate-binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, structural genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.99A {Actinobacillus succinogenes 130Z} Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 232 uroporphyrinogen-III synthase [Candidatus Liberibacter
d1jr2a_260 c.113.1.1 (A:) Uroporphyrinogen III synthase (U3S, HemD 1e-09
d1wd7a_254 c.113.1.1 (A:) Probable uroporphyrinogen-III synthase { 6e-09
>d1jr2a_ c.113.1.1 (A:) Uroporphyrinogen III synthase (U3S, HemD) {Human (Homo sapiens) [TaxId: 9606]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HemD-like
superfamily: HemD-like
family: HemD-like
domain: Uroporphyrinogen III synthase (U3S, HemD)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 56.9 bits (136), Expect = 1e-09
 Identities = 37/255 (14%), Positives = 77/255 (30%), Gaps = 32/255 (12%)

Query: 3   IVITRPIKKALRT---QEKIQKMGYIPVMMPL---SYFIHDRESVFLAMQQSYGAIAITS 56
           +++    +          ++   G    ++P+    +      S  L+  + YG +  TS
Sbjct: 4   LLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLPSFSEKLSHPEDYGGLIFTS 63

Query: 57  ----------------SESLSTLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSI 100
                           +E              ++ +G A+A L  + G         N+ 
Sbjct: 64  PRAVEAAELCLEQNNKTEVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTEGETCGNAE 123

Query: 101 NLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTM 160
            LA+ I  ++       PL++  G  +       L +  I +  I  Y +      +  +
Sbjct: 124 KLAEYICSRES---SALPLLFPCGNLKREILPKALKDKGIAMESITVYQTVAHPGIQGNL 180

Query: 161 KNLLQ---NADAILFYARSSVLYFFSL----PLPAKISAAFLCLSNNIASAIPASYKNVV 213
            +         +I F++ S + Y                 F  +    A A+ A    V 
Sbjct: 181 NSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAIGPTTARALAAQGLPVS 240

Query: 214 TVACFPKETSLLKLL 228
             A  P   +L   +
Sbjct: 241 CTAESPTPQALATGI 255


>d1wd7a_ c.113.1.1 (A:) Probable uroporphyrinogen-III synthase {Thermus thermophilus [TaxId: 274]} Length = 254 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target232 uroporphyrinogen-III synthase [Candidatus Liberibacter
d1jr2a_260 Uroporphyrinogen III synthase (U3S, HemD) {Human (Homo 100.0
d1wd7a_254 Probable uroporphyrinogen-III synthase {Thermus thermop 100.0
d1wd7a_ 254 Probable uroporphyrinogen-III synthase {Thermus thermop 98.92
d1jr2a_ 260 Uroporphyrinogen III synthase (U3S, HemD) {Human (Homo 98.85
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [TaxId 92.3
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [TaxId 90.32
>d1jr2a_ c.113.1.1 (A:) Uroporphyrinogen III synthase (U3S, HemD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HemD-like
superfamily: HemD-like
family: HemD-like
domain: Uroporphyrinogen III synthase (U3S, HemD)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.1e-42  Score=268.70  Aligned_cols=227  Identities=16%  Similarity=0.199  Sum_probs=193.5

Q ss_pred             CE-EEEECCHHHH---HHHHHHHHHCCCCEEEECCEEEECCCCCC---CCCCCCCCCEEEEECHHHHHHHHHHH------
Q ss_conf             93-8985896886---99999999879829994210000078520---01644758799984846799988620------
Q gi|255764510|r    1 MY-IVITRPIKKA---LRTQEKIQKMGYIPVMMPLSYFIHDRESV---FLAMQQSYGAIAITSSESLSTLPANF------   67 (232)
Q Consensus         1 M~-ilitRp~~~a---~~~~~~L~~~G~~~i~~Pli~i~~~~~~~---~~~~~~~~d~iiftS~~av~~~~~~~------   67 (232)
                      || ||+|||.+++   +.+.+.|+++|++++.+|+++++|.+.+.   ...++.+|||+||||+|||++++..+      
T Consensus         1 mk~il~trp~~~~~~~d~~~~~L~~~G~~~~~~P~i~i~~~~~~~~~~~l~~~~~~d~iifTS~~aV~~~~~~l~~~~~~   80 (260)
T d1jr2a_           1 MKVLLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLPSFSEKLSHPEDYGGLIFTSPRAVEAAELCLEQNNKT   80 (260)
T ss_dssp             CEEEEEESSCCCBTTBCHHHHHHHTTTCEEEEEECEEEEECCHHHHHHHHTCGGGCSEEEECCHHHHHHHHHHHHHTTCH
T ss_pred             CCEEEECCCCCCCCCCCHHHHHHHHCCCCEEEECCEEEEECCHHHHHHHHHCHHHCCEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             93899569997766401999999968992899898887608838899987283116689991734899999987762764


Q ss_pred             ----------CCCCCEECCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHH
Q ss_conf             ----------0136300041589999764101223544454567899986422012777538972156756201468984
Q gi|255764510|r   68 ----------CRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIE  137 (232)
Q Consensus        68 ----------~~~~~~~~vg~~t~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~vl~~~g~~~~~~l~~~L~~  137 (232)
                                .++.+++|+|.+|++++++.|+.....+.+.++.+.+.+..   ....++++++++|...+++|.+.|++
T Consensus        81 ~~~~~~~~~~~~~~~i~aVG~~Ta~~l~~~G~~~~~~~~~~s~~l~~~~~~---~~~~~~~il~~~g~~~~~~L~~~L~~  157 (260)
T d1jr2a_          81 EVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTEGETCGNAEKLAEYICS---RESSALPLLFPCGNLKREILPKALKD  157 (260)
T ss_dssp             HHHHHHTHHHHHHSEEEECSHHHHHHHHHTTCCCSCCSCSSHHHHHHHHHT---SCCCSSCEEEEESCGGGCCHHHHHHT
T ss_pred             HHHHHHHHHHHCCCEEEEECHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHH---HCCCCCEEEEEECCCCCHHHHHHHHH
T ss_conf             122244443211584999857999999985997520565307888998764---02567549996255530678888885


Q ss_pred             CCCEEEEEEEEEECCCCCCHHHHHHHH---CCCCEEEEECHHHHHHHHHHCCHHH----CCEEEEECCHHHHHHHHHCCC
Q ss_conf             698256768875046899988999862---3783899807899999997135440----580399718899999997699
Q gi|255764510|r  138 HKIPLRVIDCYYSQDIAYPETTMKNLL---QNADAILFYARSSVLYFFSLPLPAK----ISAAFLCLSNNIASAIPASYK  210 (232)
Q Consensus       138 ~g~~v~~~~vY~~~~~~~~~~~~~~~~---~~~d~i~f~S~~~v~~~~~~~~~~~----~~~~~~~ig~~tA~~~~~~g~  210 (232)
                      .|+.|+++++|++++...........+   ..+|+|+|||+++++.|++++....    .+..++|||++||+++++.|+
T Consensus       158 ~g~~v~~~~~Y~~~~~~~~~~~~~~~l~~~~~~d~i~f~S~s~v~~~~~~~~~~~~~~~~~~~i~~IG~~ta~~l~~~G~  237 (260)
T d1jr2a_         158 KGIAMESITVYQTVAHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAIGPTTARALAAQGL  237 (260)
T ss_dssp             TTCCEEEEECEEEEECTTHHHHHHHHHHHHCSCSEEEESSHHHHHHHHHHHHHHHGGGGGGSEEEESSHHHHHHHHHTTC
T ss_pred             CCCCCEEEEEEEEECCCCCHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCCCEEEEECHHHHHHHHHCCC
T ss_conf             49850699864454464536889999875247617862698999999999987313032583899988999999997699


Q ss_pred             CEEEECCCCCHHHHHHHHHH
Q ss_conf             66998799998899999861
Q gi|255764510|r  211 NVVTVACFPKETSLLKLLPL  230 (232)
Q Consensus       211 ~~~~va~~p~~~~ll~al~~  230 (232)
                      +++++|+.|+.++|+++|.+
T Consensus       238 ~~~~~a~~p~~e~lv~aI~~  257 (260)
T d1jr2a_         238 PVSCTAESPTPQALATGIRK  257 (260)
T ss_dssp             CCSEECSSSSHHHHHHHHHH
T ss_pred             CCEEEECCCCHHHHHHHHHH
T ss_conf             72699698998999999999



>d1wd7a_ c.113.1.1 (A:) Probable uroporphyrinogen-III synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wd7a_ c.113.1.1 (A:) Probable uroporphyrinogen-III synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jr2a_ c.113.1.1 (A:) Uroporphyrinogen III synthase (U3S, HemD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 232 uroporphyrinogen-III synthase [Candidatus Liberiba
1jr2_A_57-195139 (A:57-195) Uroporphyrinogen-III synthase; heme bio 0.002
>1jr2_A (A:57-195) Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens}Length = 139 Back     alignment and structure
 Score = 37.0 bits (85), Expect = 0.002
 Identities = 16/80 (20%), Positives = 27/80 (33%), Gaps = 3/80 (3%)

Query: 69  RHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRN 128
               ++ +G A+A L  + G         N+  LA+ I  +    +    L   G   R 
Sbjct: 57  NAKSVYVVGNATASLVSKIGLDTEGETCGNAEKLAEYICSR--ESSALPLLFPCGNLKRE 114

Query: 129 FHFEDYLIEHKIPLRVIDCY 148
                 L +  I +  I  Y
Sbjct: 115 I-LPKALKDKGIAMESITVY 133


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target232 uroporphyrinogen-III synthase [Candidatus Liberibacter
1jr2_A_57-195139 Uroporphyrinogen-III synthase; heme biosynthesis, 99.83
1wcw_A_48-161114 Uroporphyrinogen III synthase; congenital erythrop 99.45
3d8t_A_72-187116 Uroporphyrinogen-III synthase; heme biosynthesis, 99.33
3d8t_A_72-187116 Uroporphyrinogen-III synthase; heme biosynthesis, 98.83
1wcw_A_48-161114 Uroporphyrinogen III synthase; congenital erythrop 98.64
1jr2_A_57-195139 Uroporphyrinogen-III synthase; heme biosynthesis, 98.5
1jr2_A_1-56_196-286147 Uroporphyrinogen-III synthase; heme biosynthesis, 98.25
1wcw_A_1-47_162-261147 Uroporphyrinogen III synthase; congenital erythrop 96.03
3d8t_A_1-63_194-286156 Uroporphyrinogen-III synthase; heme biosynthesis, 94.47
1jr2_A_1-56_196-286147 Uroporphyrinogen-III synthase; heme biosynthesis, 94.35
>1jr2_A (A:57-195) Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens} Back     alignment and structure
Probab=99.83  E-value=3.8e-20  Score=139.79  Aligned_cols=123  Identities=17%  Similarity=0.256  Sum_probs=107.7

Q ss_pred             EEECCEEEECCCCCCCCCCCCCCCEEEEECHHHHHHHHHHH----------------CCCCCEECCCHHHHHHHHHHCCC
Q ss_conf             99421000007852001644758799984846799988620----------------01363000415899997641012
Q gi|255764510|r   27 VMMPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANF----------------CRHTPIFAIGEASACLARQKGFT   90 (232)
Q Consensus        27 i~~Pli~i~~~~~~~~~~~~~~~d~iiftS~~av~~~~~~~----------------~~~~~~~~vg~~t~~~~~~~~~~   90 (232)
                      +++|++++.+++...  ..+.+||||||||+|||++|+..+                ++..+++|+|++|++++.+.|+.
T Consensus         1 i~~p~~~~~~l~~~~--~~l~~~d~iiFTS~~aV~~~~~~l~~~~~~~~~~~~~~~~l~~~~i~~VG~~T~~~L~~~G~~   78 (139)
T 1jr2_A            1 LSFEFLSLPSFSEKL--SHPEDYGGLIFTSPRAVEAAELCLEQNNKTEVWERSLKEKWNAKSVYVVGNATASLVSKIGLD   78 (139)
T ss_dssp             EEEEECCHHHHHHHH--TCGGGCSEEEECCHHHHHHHHHHHHHTTCHHHHHHHTHHHHHHSEEEECSHHHHHHHHHTTCC
T ss_pred             EEEEECCHHHHHHHH--HCHHHCCEEEEECHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCEEEEECHHHHHHHHHCCCC
T ss_conf             888847838999987--382005689998869999999999872764012455542124785999849999999986993


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHCCCEEEEEEEEEECCCC
Q ss_conf             2354445456789998642201277753897215675620146898469825676887504689
Q gi|255764510|r   91 QIFHGKDNSINLAKIIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIA  154 (232)
Q Consensus        91 ~~~~~~~~~~~~~~ll~~~~~~~~~~~~vl~~~g~~~~~~l~~~L~~~g~~v~~~~vY~~~~~~  154 (232)
                      ...+..+.++.+.+++..   ....++++++++|+.++++|.+.|++.|+.|+++++|+|++++
T Consensus        79 ~~~~~~~~~~~L~~~l~~---~~~~~~~iL~~~~~~~~~~L~~~L~~~g~~v~~~~vY~t~~~P  139 (139)
T 1jr2_A           79 TEGETCGNAEKLAEYICS---RESSALPLLFPCGNLKREILPKALKDKGIAMESITVYQTVAHP  139 (139)
T ss_dssp             CSCCSCSSHHHHHHHHHT---SCCCSSCEEEEESCGGGCCHHHHHHTTTCCEEEEECEEEEECT
T ss_pred             CCCCCCCCHHHHHHHHHH---HCCCCCEEEEEECCCCHHHHHHHHHHCCCCCCEEEEEEECCCC
T ss_conf             336788899999999987---4468982899724665078999998579987334677310488



>1wcw_A (A:48-161) Uroporphyrinogen III synthase; congenital erythropoietic porphyria, structural genomics, riken structural genomics/proteomics initiative; 1.30A {Thermus thermophilus} PDB: 1wd7_A 1wcx_A Back     alignment and structure
>3d8t_A (A:72-187) Uroporphyrinogen-III synthase; heme biosynthesis, lyase; 1.60A {Thermus thermophilus} PDB: 3d8r_A 3d8s_A 3d8n_A Back     alignment and structure
>3d8t_A (A:72-187) Uroporphyrinogen-III synthase; heme biosynthesis, lyase; 1.60A {Thermus thermophilus} PDB: 3d8r_A 3d8s_A 3d8n_A Back     alignment and structure
>1wcw_A (A:48-161) Uroporphyrinogen III synthase; congenital erythropoietic porphyria, structural genomics, riken structural genomics/proteomics initiative; 1.30A {Thermus thermophilus} PDB: 1wd7_A 1wcx_A Back     alignment and structure
>1jr2_A (A:57-195) Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens} Back     alignment and structure
>1jr2_A (A:1-56,A:196-286) Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens} Back     alignment and structure
>1wcw_A (A:1-47,A:162-261) Uroporphyrinogen III synthase; congenital erythropoietic porphyria, structural genomics, riken structural genomics/proteomics initiative; 1.30A {Thermus thermophilus} PDB: 1wd7_A 1wcx_A Back     alignment and structure
>3d8t_A (A:1-63,A:194-286) Uroporphyrinogen-III synthase; heme biosynthesis, lyase; 1.60A {Thermus thermophilus} PDB: 3d8r_A 3d8s_A 3d8n_A Back     alignment and structure
>1jr2_A (A:1-56,A:196-286) Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens} Back     alignment and structure