254781034

254781034

hypothetical protein CLIBASIA_04680

GeneID in NCBI database:8210057Locus tag:CLIBASIA_04680
Protein GI in NCBI database:254781034Protein Accession:YP_003065447.1
Gene range:-(1037794, 1038828)Protein Length:344aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MSDSSMEKDIRRSTESPKQEETSPPSCDVKKITWRKFFWEKILSNKTFFKILALVCVIVLTFIFIFTALFTEKFLRTDNNLLLLPSVSPLKEDPKDISPVIEKEIISQNLSIAQQKDEETADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDKGEYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKFPKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTGDLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEMAKIPQTDLP
cccHHHHHHHHHHcccccHHcccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHcHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
cccccHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccHHcHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccEEEccccccccccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
msdssmekdirrstespkqeetsppscdvkkitWRKFFWEKILSNKTFFKILALVCVIVLTFIFIFTALFTEKFlrtdnnllllpsvsplkedpkdispvIEKEIISQNLSIAQQKDEETADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRLTKMEtltanplrnpntQRMVSLLILKNAldkgeysslntTMQENFSVLKPCTATLMQfanikiptTIEILAKFPKVSEEMVFASESLEKDSGFANYLLFQLTRLVkvrpiggniegdAITDVIARIENNLKTGDLVKAAAewdkipekarqpSMFLRNALEAHICSDAILKEEMakipqtdlp
msdssmekdirrstespkqeetsppscdvkkiTWRKFFWEKILSNKTFFKILALVCVIVLTFIFIFTALFTEKFLRTDNNLLllpsvsplkedpKDISPVIEKEIISQNLSIAQQKDEETADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRLTKMetltanplrnpntqRMVSLLILKNALDKGEYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKFPKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTGDLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEmakipqtdlp
MSDSSMEKDIRRSTESPKQEETSPPSCDVKKITWRKFFWEKILSNKTFFKILAlvcvivltfififtalftEKFLRTDnnllllpsvsplKEDPKDISPVIEKEIISQNLSIAQQKDEETADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDKGEYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKFPKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTGDLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEMAKIPQTDLP
***************************************EKILSNKTFFKILALVCVIVLTFIFIFTALFT*********************************************************************************************************TQRMVSLLILKNALDKGEYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKFPKVSE******************LLFQLTRL*****************VIARIENNLKTGDLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEE***I******
**************************CDVKKITWRKFFWEKILSNKTFFKILALVCVIVLTFIFIFTALFTEKFLRTDNNLLLLPSVSPLKEDPKDISPVIEKEIISQNLSIAQQKDEETADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDKGEYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKFPKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTGDLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEMA********
***********************PPSCDVKKITWRKFFWEKILSNKTFFKILALVCVIVLTFIFIFTALFTEKFLRTDNNLLLLPSVSPLKEDPKDISPVIEKEIISQNLSIAQQKDEETADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDKGEYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKFPKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTGDLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEMAKIP*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDSSMEKDIRRSTESPKQEETSPPSCDVKKITWRKFFWEKILSNKTFFKILALVCVIVLTFIFIFTALFTEKFLRTDNNLLLLPSVSPLKEDPKDISPVIEKEIISQNLSIAQQKDEETADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDKGEYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKFPKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTGDLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEMAKIPQTDLP
MSDSSMEKDIRRSTESPKQEETSPPSCDVKKITWRKFFWEKILSNKTFFKILALVCVIVLTFIFIFTALFTEKFLRTDNNLLLLPSVSPLKEDPKDISPVIEKEIISQNLSIAQQKDEETADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDKGEYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKFPKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTGDLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEMAKIPQTDLP
MSDSSMEKDIRRSTESPKQEETSPPSCDVKKITWRKFFWEKILSNKTFFKILALVCVIVLTFIFIFTALFTEKFLRTDNNLLLLPSVSPLKEDPKDISPVIEKEIISQNLSIAQQKDEETADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDKGEYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKFPKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTGDLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEMAKIPQTDLP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target344 hypothetical protein CLIBASIA_04680 [Candidatus Liberib
315122374343 hypothetical protein CKC_03130 [Candidatus Liberibacter 1 5e-80
222150057461 hypothetical protein Avi_4147 [Agrobacterium vitis S4] 1 2e-16
159185309481 hypothetical protein Atu2655 [Agrobacterium tumefaciens 1 2e-15
325294023480 hypothetical protein AGROH133_08879 [Agrobacterium sp. 1 9e-15
319404859391 conserved hypothetical protein [Bartonella rochalimae A 1 9e-15
209551273428 hypothetical protein Rleg2_3701 [Rhizobium leguminosaru 1 9e-15
327188881421 hypothetical protein RHECNPAF_750032 [Rhizobium etli CN 1 1e-14
153008312452 hypothetical protein Oant_0977 [Ochrobactrum anthropi A 1 1e-14
218672802257 hypothetical protein RetlG_14772 [Rhizobium etli GR56] 1 2e-14
190893755416 hypothetical protein RHECIAT_CH0004190 [Rhizobium etli 1 2e-14
>gi|315122374|ref|YP_004062863.1| hypothetical protein CKC_03130 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 343 Back     alignment and organism information
 Score =  302 bits (774), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 173/348 (49%), Positives = 239/348 (68%), Gaps = 14/348 (4%)

Query: 1   MSDSSMEKDIRRSTESPKQEETSPPSCDVKKITWRKFFWEKILSNKTFFKILALVCVIVL 60
           +SD S E D+  S +S +QE+T   S   ++   + F + K   N TFFK L+++ + +L
Sbjct: 4   ISDHSTENDMNDSKKSHEQEKTIHQSLGTQEKKSKGFPFIKNCKNLTFFKALSIIVIGIL 63

Query: 61  TFIFIFTALFTEKFLRTDNNLLL----LPSVSPLKEDPKDISPV-IEKEIISQNLSIAQQ 115
              F+   LF  K     NN L     LPS   L +  KD S +  E++ I     +A++
Sbjct: 64  LISFVLILLFFIKIKIFSNNDLFFVNALPSKGVLIQSDKDYSILESERKNIQNTTPVAEK 123

Query: 116 KDEETADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRLTKMETLTANPLRNP 175
           K+         N +N + + L+EEI SLK+++++L+ NY +++TRL K E L ANPL+N 
Sbjct: 124 KE---------NEKNASTQVLIEEINSLKKILTELNNNYNNLLTRLIKTENLIANPLKNT 174

Query: 176 NTQRMVSLLILKNALDKGEYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILAKFP 235
           N QR++SLLILKN +DKGEY  LN  + E  SVL+PCTA L+QF+NI+IPT+IEI  +F 
Sbjct: 175 NIQRIISLLILKNKMDKGEYFLLNKKITEEASVLEPCTAVLLQFSNIRIPTSIEIFTQFS 234

Query: 236 KVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLKTGD 295
           KVSEE++FASE+L KDSGF +YLL QL +L+K+RP+GG++EGD IT ++ARIENNLK GD
Sbjct: 235 KVSEEIIFASETLGKDSGFTSYLLLQLNKLIKIRPLGGDVEGDTITALVARIENNLKKGD 294

Query: 296 LVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEMAKIPQTDL 343
           L  AA EWDKIPE+ R+P +FLRNALEAHICSD+I+KEEM+KI Q +L
Sbjct: 295 LRSAAIEWDKIPEETRKPGIFLRNALEAHICSDSIIKEEMSKISQDNL 342


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222150057|ref|YP_002551014.1| hypothetical protein Avi_4147 [Agrobacterium vitis S4] Length = 461 Back     alignment and organism information
>gi|159185309|ref|NP_355591.2| hypothetical protein Atu2655 [Agrobacterium tumefaciens str. C58] Length = 481 Back     alignment and organism information
>gi|325294023|ref|YP_004279887.1| hypothetical protein AGROH133_08879 [Agrobacterium sp. H13-3] Length = 480 Back     alignment and organism information
>gi|319404859|emb|CBI78460.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 391 Back     alignment and organism information
>gi|209551273|ref|YP_002283190.1| hypothetical protein Rleg2_3701 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 428 Back     alignment and organism information
>gi|327188881|gb|EGE56073.1| hypothetical protein RHECNPAF_750032 [Rhizobium etli CNPAF512] Length = 421 Back     alignment and organism information
>gi|153008312|ref|YP_001369527.1| hypothetical protein Oant_0977 [Ochrobactrum anthropi ATCC 49188] Length = 452 Back     alignment and organism information
>gi|218672802|ref|ZP_03522471.1| hypothetical protein RetlG_14772 [Rhizobium etli GR56] Length = 257 Back     alignment and organism information
>gi|190893755|ref|YP_001980297.1| hypothetical protein RHECIAT_CH0004190 [Rhizobium etli CIAT 652] Length = 416 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target344 hypothetical protein CLIBASIA_04680 [Candidatus Liberib
pfam09731561 pfam09731, Mitofilin, Mitochondrial inner membrane prot 1e-04
COG4223422 COG4223, COG4223, Uncharacterized protein conserved in 2e-19
>gnl|CDD|150410 pfam09731, Mitofilin, Mitochondrial inner membrane protein Back     alignment and domain information
>gnl|CDD|33948 COG4223, COG4223, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 344 hypothetical protein CLIBASIA_04680 [Candidatus Liberib
COG4223422 Uncharacterized protein conserved in bacteria [Function 100.0
pfam09731561 Mitofilin Mitochondrial inner membrane protein. Mitofil 100.0
KOG1854657 consensus 99.8
PRK10920389 putative uroporphyrinogen III C-methyltransferase; Prov 95.85
PRK06975653 bifunctional uroporphyrinogen-III synthetase/uroporphyr 95.54
pfam01601 609 Corona_S2 Coronavirus S2 glycoprotein. The coronavirus 94.62
>COG4223 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam09731 Mitofilin Mitochondrial inner membrane protein Back     alignment and domain information
>KOG1854 consensus Back     alignment and domain information
>PRK10920 putative uroporphyrinogen III C-methyltransferase; Provisional Back     alignment and domain information
>PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>pfam01601 Corona_S2 Coronavirus S2 glycoprotein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00