255764514

255764514

DNA repair protein RecN

GeneID in NCBI database:8210198Locus tag:CLIBASIA_05400
Protein GI in NCBI database:255764514Protein Accession:YP_003065586.2
Gene range:-(1171422, 1173086)Protein Length:554aa
Gene description:DNA repair protein RecN
COG prediction:[L] ATPase involved in DNA repair
KEGG prediction:recN; DNA repair protein RecN; K03631 DNA repair protein RecN (Recombination protein N)
SEED prediction:DNA repair protein RecN
Pathway involved in KEGG:not defined
Subsystem involved in SEED:DNA-replication;
DNA repair, bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550----
MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHKSSSPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERREEIARMLAGSHITEEARAAAEILLEFQ
ccEEEEEEEEEEEEEEEEccccEEEEEccccccHHHHHHHHHHHHccccccHHHHccccEEEEEEEEEccccHHHHHHHHHcccccccEEEEEEEEEccccEEEEEccEEEEHHHHHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccccEEEEEEEEccccccccHHHHHccHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEccHHHHHHccccEEEEEEEEccccccEEEEEEEEEcHHHHHHHHHHHHccccccHHHHHHHHHHHccc
ccEEEEccEEEEEEEEEEcccccEEEEcccccHHHHHHHHHHHHHcccccccEEccccccEEEEEEEEccccHHHHHHHHHccccccccEEEEEEEEccccEEEEEccccccHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccEEEEEEEcccccccccHHHHccccHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEEcccHEEEEcccEEEEEEEccccccccEEEEEEEccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcc
MTRLSIYNIVLIesldidfsaglsilsgdtgsgksILLDALILVTggrgdgglvrrhaeKGQVVAVFEISHLPALEILFAEANLTLEKHVILRrvqfpdgrtkayvNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQeqksssqdVEFLRFSIDELQAlavqpgeeneLVVMRSKILKQERIAVELSSImddfhkssspiSVISSMLRRLerkstevpdLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMaempalkleNVCFTVnitsdkedispdgidRVEFYVQtnrgenpgplmklasggELSRFLLALKIVLVdqgsiptlvfdevdsgiggAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVyktnkpddtqrIETYVAVLTPQERREEIARMLAGSHITEEARAAAEILLEFQ
MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFAEANLTLEKHVILRrvqfpdgrtkaYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQAlavqpgeeneLVVMRSKILKQERIAVELSsimddfhkssspisvISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVSIDQLPELAKKMEEDLadisegnekVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITsdkedispdgiDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYktnkpddtqrietyvavltpqerREEIARMLAGSHITEEARAAAEILLEFQ
MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHKssspisvissMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERREEIARMLAGSHITeearaaaeilleFQ
MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGTLYRHWCCTA******************LRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHKSSSPISVISS***************LQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVSIDQLPELAKKMEEDLA*************RVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNK*****RI***VAVLTPQERREEIARMLAGSHITEEARAAAEILLEF*
MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKK**********VEFLRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHKSSSPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERREEIARMLAGSHITEEARAAAEILLEFQ
MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHKSSSPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERREEIARMLAGSHITEEARAAAEILLEFQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHKSSSPISVISSMLRRLERKSTEVPDLLQKSISFxxxxxxxxxxxxxxxxxxxxxIQYDAQELANIEERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERREEIARMLAGSHITEEARAAAEILLEFQ
MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHKSSSPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERREEIARMLAGSHITEEARAAAEILLEFQ
MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEKGQVVAVFEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVGSLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKSSSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHKSSSPISVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIEERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQDISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGENPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERREEIARMLAGSHITEEARAAAEILLEFQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target554 DNA repair protein RecN [Candidatus Liberibacter asiati
254780766375 recombination protein F [Candidatus Liberibacter a 0.040
>gi|254780766|ref|YP_003065179.1| recombination protein F [Candidatus Liberibacter asiaticus str. psy62] Length = 375 Back     alignment
 Score = 31.2 bits (69), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 14 SLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRG 49
          SL + F A  +I  GD G GK+ +L+A+  ++ GRG
Sbjct: 20 SLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRG 55

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target554 DNA repair protein RecN [Candidatus Liberibacter asiati
315122568558 DNA repair protein RecN [Candidatus Liberibacter solana 1 0.0
15889367557 DNA repair protein RecN [Agrobacterium tumefaciens str. 1 1e-158
190892572557 DNA repair protein [Rhizobium etli CIAT 652] Length = 5 1 1e-157
327194612557 DNA repair protein [Rhizobium etli CNPAF512] Length = 5 1 1e-156
222149126557 DNA repair protein RecN [Agrobacterium vitis S4] Length 1 1e-156
116253036557 DNA repair protein [Rhizobium leguminosarum bv. viciae 1 1e-156
86358440557 DNA repair protein [Rhizobium etli CFN 42] Length = 557 1 1e-154
241205545557 DNA repair protein RecN [Rhizobium leguminosarum bv. tr 1 1e-154
15965918557 DNA repair protein [Sinorhizobium meliloti 1021] Length 1 1e-153
209550163557 DNA repair protein RecN [Rhizobium leguminosarum bv. tr 1 1e-153
>gi|315122568|ref|YP_004063057.1| DNA repair protein RecN [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 558 Back     alignment and organism information
 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/554 (73%), Positives = 480/554 (86%), Gaps = 1/554 (0%)

Query: 1   MTRLSIYNIVLIESLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRGDGGLVRRHAEK 60
           +T LSI NIV+IE+LDIDFSAGLSILSG+TGSGKSI+LDAL L  GGRGDGGLVRRH EK
Sbjct: 2   LTHLSIRNIVIIENLDIDFSAGLSILSGETGSGKSIVLDALFLAIGGRGDGGLVRRHTEK 61

Query: 61  GQVVAVFEISHLPALEILFAEANLTLEKHVILRRVQFPDGRTKAYVNDQVVSVNFMRAVG 120
           GQV+AVF++S + AL+ +FAEAN+TLE +VILRRVQFPDGRTKAYVNDQ+VSVNFMR+VG
Sbjct: 62  GQVIAVFDVSPVEALKNMFAEANITLEDNVILRRVQFPDGRTKAYVNDQLVSVNFMRSVG 121

Query: 121 SLLIEIHSQHADRSLLDVQGHRKILDSYADIDLSLCELGTLYRHWCCTADALKKYQEQKS 180
           SLLIEI+SQHADRSL+DV  HRKILDSYA++   L  LG LYR+W   +DAL++Y+ +K 
Sbjct: 122 SLLIEINSQHADRSLIDVSEHRKILDSYANLAEDLDNLGILYRNWRQASDALQEYKTKKK 181

Query: 181 -SSQDVEFLRFSIDELQALAVQPGEENELVVMRSKILKQERIAVELSSIMDDFHKSSSPI 239
            S+QD++FLRFS++ELQ+LAVQP EEN+L  MRS+I+K+ERIAVEL+SI++DF++SSSPI
Sbjct: 182 FSAQDIDFLRFSVEELQSLAVQPEEENQLAEMRSRIVKKERIAVELASIIEDFNQSSSPI 241

Query: 240 SVISSMLRRLERKSTEVPDLLQKSISFLNEAQENLSDAQHEIERSFSEIQYDAQELANIE 299
           +++ S+LRRLERK+TE PDLL ++ISFLNEAQ NLSDAQHEIE+ F+EIQYDAQEL NIE
Sbjct: 242 AIVCSILRRLERKNTEFPDLLTEAISFLNEAQANLSDAQHEIEKRFAEIQYDAQELENIE 301

Query: 300 ERLFALRAMSRKYSVSIDQLPELAKKMEEDLADISEGNEKVVSLERVLYEARQAYDRVAQ 359
           ERLFALRAMSRKYSVS+DQ+PEL KKM +DL DI  G+E++ S ER L E+RQ Y+  AQ
Sbjct: 302 ERLFALRAMSRKYSVSVDQIPELVKKMAKDLDDIHAGSEELCSFERALDESRQVYNHAAQ 361

Query: 360 DISTKRYQFAKMLEKNVMAEMPALKLENVCFTVNITSDKEDISPDGIDRVEFYVQTNRGE 419
           +IS KR  FAK+LEKN+M E+ ALKLENV F VNITSD +DIS  GIDR+EFYV+TN GE
Sbjct: 362 NISEKRRHFAKILEKNIMKEIAALKLENVLFIVNITSDIQDISFHGIDRIEFYVRTNLGE 421

Query: 420 NPGPLMKLASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK 479
           +PGPLMKLASGGELSRFLLALKIVLVD+GS+PTLVFDEVDSG+GGAVADAIGYRLK+LS 
Sbjct: 422 SPGPLMKLASGGELSRFLLALKIVLVDRGSVPTLVFDEVDSGVGGAVADAIGYRLKKLST 481

Query: 480 KIQLLAVTHAPQVAARADRHFLVYKTNKPDDTQRIETYVAVLTPQERREEIARMLAGSHI 539
           K QLL +TH PQVAARAD HFLV K    ++ +R ET V VLTPQER EEIARMLAGSH+
Sbjct: 482 KNQLLVITHTPQVAARADVHFLVSKKKNLENMERTETTVVVLTPQERCEEIARMLAGSHV 541

Query: 540 TEEARAAAEILLEF 553
           TEEARAAA  L+E 
Sbjct: 542 TEEARAAAVRLVEL 555


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15889367|ref|NP_355048.1| DNA repair protein RecN [Agrobacterium tumefaciens str. C58] Length = 557 Back     alignment and organism information
>gi|190892572|ref|YP_001979114.1| DNA repair protein [Rhizobium etli CIAT 652] Length = 557 Back     alignment and organism information
>gi|327194612|gb|EGE61462.1| DNA repair protein [Rhizobium etli CNPAF512] Length = 557 Back     alignment and organism information
>gi|222149126|ref|YP_002550083.1| DNA repair protein RecN [Agrobacterium vitis S4] Length = 557 Back     alignment and organism information
>gi|116253036|ref|YP_768874.1| DNA repair protein [Rhizobium leguminosarum bv. viciae 3841] Length = 557 Back     alignment and organism information
>gi|86358440|ref|YP_470332.1| DNA repair protein [Rhizobium etli CFN 42] Length = 557 Back     alignment and organism information
>gi|241205545|ref|YP_002976641.1| DNA repair protein RecN [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 557 Back     alignment and organism information
>gi|15965918|ref|NP_386271.1| DNA repair protein [Sinorhizobium meliloti 1021] Length = 557 Back     alignment and organism information
>gi|209550163|ref|YP_002282080.1| DNA repair protein RecN [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 557 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target554 DNA repair protein RecN [Candidatus Liberibacter asiati
TIGR00634563 TIGR00634, recN, DNA repair protein RecN 1e-104
PRK10869553 PRK10869, PRK10869, recombination and repair protein; P 4e-87
COG0497557 COG0497, RecN, ATPase involved in DNA repair [DNA repli 1e-143
cd03241276 cd03241, ABC_RecN, RecN ATPase involved in DNA repair; 1e-42
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 1e-05
cd03272243 cd03272, ABC_SMC3_euk, Eukaryotic SMC3 proteins; SMC pr 3e-05
cd03241276 cd03241, ABC_RecN, RecN ATPase involved in DNA repair; 1e-35
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell divi 1e-07
COG3950440 COG3950, COG3950, Predicted ATP-binding protein involve 3e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 5e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 5e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 2e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell divi 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation protein S 0.002
KOG09641200 KOG0964, KOG0964, KOG0964, Structural maintenance of ch 5e-06
cd03278197 cd03278, ABC_SMC_barmotin, Barmotin is a tight junction 3e-05
COG1195363 COG1195, RecF, Recombinational DNA repair ATPase (RecF 1e-04
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 3e-04
cd03276198 cd03276, ABC_SMC6_euk, Eukaryotic SMC6 proteins; SMC pr 0.001
cd03242270 cd03242, ABC_RecF, RecF is a recombinational DNA repair 0.001
cd03240204 cd03240, ABC_Rad50, The catalytic domains of Rad50 are 0.003
PRK00064361 PRK00064, recF, recombination protein F; Reviewed 0.003
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation protein S 3e-04
KOG0161 1930 KOG0161, KOG0161, KOG0161, Myosin class II heavy chain 4e-04
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucleic a 0.002
>gnl|CDD|161971 TIGR00634, recN, DNA repair protein RecN Back     alignment and domain information
>gnl|CDD|182794 PRK10869, PRK10869, recombination and repair protein; Provisional Back     alignment and domain information
>gnl|CDD|30843 COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|73000 cd03241, ABC_RecN, RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|72986 cd03227, ABC_Class2, ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>gnl|CDD|73031 cd03272, ABC_SMC3_euk, Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>gnl|CDD|73000 cd03241, ABC_RecN, RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|31389 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|33731 COG3950, COG3950, Predicted ATP-binding protein involved in virulence [General function prediction only] Back     alignment and domain information
>gnl|CDD|30768 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|145545 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|30768 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31389 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|162740 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|36182 KOG0964, KOG0964, KOG0964, Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|73037 cd03278, ABC_SMC_barmotin, Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>gnl|CDD|31388 COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|72986 cd03227, ABC_Class2, ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>gnl|CDD|73035 cd03276, ABC_SMC6_euk, Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>gnl|CDD|73001 cd03242, ABC_RecF, RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>gnl|CDD|72999 cd03240, ABC_Rad50, The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>gnl|CDD|178835 PRK00064, recF, recombination protein F; Reviewed Back     alignment and domain information
>gnl|CDD|162740 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|35383 KOG0161, KOG0161, KOG0161, Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|31767 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 554 DNA repair protein RecN [Candidatus Liberibacter asiati
PRK10869553 recombination and repair protein; Provisional 100.0
COG0497557 RecN ATPase involved in DNA repair [DNA replication, re 100.0
TIGR00634605 recN DNA repair protein RecN; InterPro: IPR004604 DNA r 100.0
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-b 100.0
TIGR021681191 SMC_prok_B chromosome segregation protein SMC; InterPro 100.0
pfam024631162 SMC_N RecF/RecN/SMC N terminal domain. This domain is f 100.0
COG11961163 Smc Chromosome segregation ATPases [Cell division and c 100.0
KOG09961293 consensus 100.0
KOG00181141 consensus 100.0
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 97.3
TIGR02169 1202 SMC_prok_A chromosome segregation protein SMC; InterPro 100.0
KOG0933 1174 consensus 100.0
PRK00064355 recF recombination protein F; Reviewed 99.93
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPase th 99.9
COG1195363 RecF Recombinational DNA repair ATPase (RecF pathway) [ 99.84
TIGR00611399 recf DNA replication and repair protein RecF; InterPro: 99.63
TIGR02168 1191 SMC_prok_B chromosome segregation protein SMC; InterPro 97.94
PRK02224880 chromosome segregation protein; Provisional 100.0
PRK01156895 chromosome segregation protein; Provisional 100.0
PRK03918882 chromosome segregation protein; Provisional 100.0
KOG09641200 consensus 100.0
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are 100.0
COG0419908 SbcC ATPase involved in DNA repair [DNA replication, re 100.0
cd03239178 ABC_SMC_head The structural maintenance of chromosomes 99.96
PRK102461047 exonuclease subunit SbcC; Provisional 99.92
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 99.87
TIGR006181063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 99.74
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 99.66
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 99.58
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 99.58
KOG02501074 consensus 99.5
COG4717984 Uncharacterized conserved protein [Function unknown] 99.2
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 98.74
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 98.73
COG4637373 Predicted ATPase [General function prediction only] 98.73
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 98.72
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 98.69
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 98.68
PRK10789569 putative multidrug transporter membrane\ATP-binding com 98.66
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 98.64
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 98.63
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 98.61
COG4988559 CydD ABC-type transport system involved in cytochrome b 98.61
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 98.61
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 98.6
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 98.59
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 98.58
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 98.56
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 98.56
cd03246173 ABCC_Protease_Secretion This family represents the ABC 98.55
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 98.53
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 98.53
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 98.53
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 98.52
PRK10790593 putative multidrug transporter membrane\ATP-binding com 98.52
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 98.5
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 98.49
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 98.48
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 98.46
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 98.46
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 98.45
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 98.45
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.44
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 98.42
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 98.42
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 98.42
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 98.41
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 98.4
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 98.39
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 98.39
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 98.39
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 98.39
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 98.39
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 98.39
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 98.38
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 98.38
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.38
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 98.37
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.36
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 98.36
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 98.35
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 98.35
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 98.34
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 98.34
cd03234226 ABCG_White The White subfamily represents ABC transport 98.33
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.33
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 98.32
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 98.31
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 98.31
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 98.31
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 98.31
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.31
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 98.28
PRK10744257 phosphate transporter subunit; Provisional 98.28
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 98.27
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 98.27
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 98.26
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.26
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 98.26
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 98.24
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.24
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 98.23
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 98.23
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 98.23
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.23
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 98.22
PRK13544208 consensus 98.22
PRK10908222 cell division protein FtsE; Provisional 98.22
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 98.22
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.21
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.21
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 98.2
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.2
PRK10522547 multidrug transporter membrane component/ATP-binding co 98.2
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 98.2
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttransla 98.19
PRK13409590 putative ATPase RIL; Provisional 98.19
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.18
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.18
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 98.17
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 98.17
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.16
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 98.16
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.15
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 98.15
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 98.14
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 98.14
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 98.14
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 98.14
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 98.14
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 98.13
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 98.13
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.13
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 98.13
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.12
PRK11147632 ABC transporter ATPase component; Reviewed 98.12
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 98.1
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 98.1
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 98.09
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 98.09
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 98.09
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 98.08
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 98.08
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 98.08
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 98.07
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.07
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 98.07
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.07
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 98.06
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.06
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 98.06
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 98.06
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 98.06
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 98.06
PRK13542224 consensus 98.05
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 98.05
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 98.05
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 98.04
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 98.04
PRK10636638 putative ABC transporter ATP-binding protein; Provision 98.04
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 98.03
COG4181228 Predicted ABC-type transport system involved in lysopho 98.03
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 98.02
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 98.02
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 98.02
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 98.01
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 98.01
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 98.0
PRK03695245 vitamin B12-transporter ATPase; Provisional 98.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 97.98
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 97.97
COG0488530 Uup ATPase components of ABC transporters with duplicat 97.97
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 97.96
COG1123539 ATPase components of various ABC-type transport systems 97.96
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 97.95
PTZ002431560 ABC transporter; Provisional 97.94
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 97.92
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 97.92
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 97.91
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 97.9
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 97.9
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 97.89
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 97.89
PTZ002651467 multidrug resistance protein (mdr1); Provisional 97.88
PRK09700510 D-allose transporter ATP-binding protein; Provisional 97.88
PRK10762501 D-ribose transporter ATP binding protein; Provisional 97.87
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 97.87
COG4987573 CydC ABC-type transport system involved in cytochrome b 97.85
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 97.84
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 97.83
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 97.82
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 97.82
KOG0057591 consensus 97.81
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 97.79
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 97.78
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 97.78
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 97.77
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 97.72
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 97.72
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 97.72
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 97.71
PRK00635 1809 excinuclease ABC subunit A; Provisional 97.71
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 97.71
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 97.69
PRK00349944 uvrA excinuclease ABC subunit A; Reviewed 97.67
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 97.67
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 97.63
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 97.62
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 97.58
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are 97.57
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 97.54
PRK13536306 nodulation factor exporter subunit NodI; Provisional 97.52
KOG09621294 consensus 97.51
PRK006351809 excinuclease ABC subunit A; Provisional 97.48
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 97.46
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 97.43
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 97.39
COG4988559 CydD ABC-type transport system involved in cytochrome b 97.39
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 97.36
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 97.33
KOG0058716 consensus 97.33
KOG0062582 consensus 97.29
KOG00541381 consensus 97.27
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 97.27
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 97.27
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 97.26
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 97.26
TIGR00954788 3a01203 Peroxysomal long chain fatty acyl transporter; 97.25
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 97.22
COG1129500 MglA ABC-type sugar transport system, ATPase component 97.21
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 97.19
COG4178604 ABC-type uncharacterized transport system, permease and 97.15
TIGR02633501 xylG D-xylose ABC transporter, ATP-binding protein; Int 97.14
KOG0060659 consensus 97.11
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, reco 97.09
TIGR006061328 rad50 rad50; InterPro: IPR004584 Rad50 is involved in r 97.05
COG1127263 Ttg2A ABC-type transport system involved in resistance 97.02
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are 100.0
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are 100.0
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are 100.0
KOG0979 1072 consensus 100.0
KOG0250 1074 consensus 99.98
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. This m 99.9
COG4717 984 Uncharacterized conserved protein [Function unknown] 98.11
TIGR01188343 drrA daunorubicin resistance ABC transporter, ATP-bindi 97.41
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are 99.87
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are 99.64
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes ar 99.5
COG3950440 Predicted ATP-binding protein involved in virulence [Ge 99.44
PRK10246 1047 exonuclease subunit SbcC; Provisional 99.36
KOG0962 1294 consensus 99.26
pfam12128 1192 DUF3584 Protein of unknown function (DUF3584). This pro 99.18
TIGR00606 1328 rad50 rad50; InterPro: IPR004584 Rad50 is involved in r 99.14
COG3593581 Predicted ATP-dependent endonuclease of the OLD family 98.96
COG1106371 Predicted ATPases [General function prediction only] 98.82
COG5293591 Predicted ATPase [General function prediction only] 98.77
TIGR00618 1063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 98.74
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 98.31
COG3910233 Predicted ATPase [General function prediction only] 98.23
COG4604252 CeuD ABC-type enterochelin transport system, ATPase com 98.09
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 97.86
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 97.74
COG4938374 Uncharacterized conserved protein [Function unknown] 97.59
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 97.32
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 97.22
PRK04863 1486 mukB cell division protein MukB; Provisional 98.92
PRK10535648 macrolide transporter ATP-binding /permease protein; Pr 98.74
COG4637373 Predicted ATPase [General function prediction only] 98.29
TIGR02680 1416 TIGR02680 conserved hypothetical protein TIGR02680; Int 98.29
TIGR00955671 3a01204 Pigment precourser permease; InterPro: IPR00528 98.22
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 98.17
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 98.16
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 98.14
COG4913 1104 Uncharacterized protein conserved in bacteria [Function 98.13
PRK13544208 consensus 98.11
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 98.11
COG4559259 ABC-type hemin transport system, ATPase component [Inor 98.1
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 98.1
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 98.1
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 98.08
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 98.08
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 98.07
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 98.07
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 98.06
cd03234226 ABCG_White The White subfamily represents ABC transport 98.06
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 98.05
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 98.04
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 98.04
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 98.03
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.02
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 98.01
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.01
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 98.01
PRK13549513 xylose transporter ATP-binding subunit; Provisional 98.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 98.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 97.99
PRK09984262 phosphonate/organophosphate ester transporter subunit; 97.98
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 97.97
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 97.97
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.97
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 97.96
PRK13409590 putative ATPase RIL; Provisional 97.96
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 97.96
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 97.95
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 97.94
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.94
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 97.93
PRK10744257 phosphate transporter subunit; Provisional 97.93
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 97.92
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 97.91
PRK03695245 vitamin B12-transporter ATPase; Provisional 97.91
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 97.91
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 97.9
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 97.9
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 97.9
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 97.9
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 97.89
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 97.88
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 97.88
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 97.88
PRK13542224 consensus 97.88
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 97.87
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 97.87
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 97.87
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 97.87
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 97.87
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 97.87
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.86
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 97.86
PRK11147632 ABC transporter ATPase component; Reviewed 97.84
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 97.84
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 97.84
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 97.84
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 97.83
cd03246173 ABCC_Protease_Secretion This family represents the ABC 97.83
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 97.83
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 97.83
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 97.82
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 97.82
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 97.82
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 97.82
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.82
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 97.81
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.81
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.81
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 97.8
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.8
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.79
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.79
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 97.79
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 97.78
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.78
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 97.78
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 97.78
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 97.78
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 97.78
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.78
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.77
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 97.77
KOG0061613 consensus 97.77
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.77
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 97.77
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 97.77
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 97.76
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.76
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.76
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 97.76
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 97.76
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.75
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 97.75
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 97.75
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 97.75
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 97.75
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.75
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.75
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 97.74
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 97.74
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 97.74
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 97.74
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 97.74
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 97.74
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 97.73
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 97.73
PRK10636638 putative ABC transporter ATP-binding protein; Provision 97.73
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 97.73
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 97.73
COG3839338 MalK ABC-type sugar transport systems, ATPase component 97.73
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 97.73
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 97.73
PRK09700510 D-allose transporter ATP-binding protein; Provisional 97.73
PRK10908222 cell division protein FtsE; Provisional 97.72
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 97.72
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.72
COG4133209 CcmA ABC-type transport system involved in cytochrome c 97.71
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 97.71
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 97.71
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.7
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 97.7
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 97.7
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 97.7
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 97.69
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 97.69
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 97.69
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 97.68
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 97.68
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 97.67
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 97.67
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 97.67
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 97.67
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 97.66
PRK10762501 D-ribose transporter ATP binding protein; Provisional 97.66
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 97.66
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 97.65
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 97.65
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 97.64
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 97.64
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 97.64
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 97.64
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 97.64
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 97.64
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 97.63
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 97.62
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 97.62
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 97.62
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 97.61
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 97.61
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 97.61
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 97.6
PRK13536306 nodulation factor exporter subunit NodI; Provisional 97.59
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 97.58
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 97.57
TIGR01189204 ccmA heme ABC exporter, ATP-binding protein CcmA; Inter 97.55
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 97.54
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 97.54
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 97.53
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 97.51
COG4674249 Uncharacterized ABC-type transport system, ATPase compo 97.51
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 97.5
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 97.49
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttransla 97.48
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 97.47
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 97.43
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 97.41
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 97.4
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 97.4
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 97.4
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 97.39
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 97.37
COG4619223 ABC-type uncharacterized transport system, ATPase compo 97.34
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 97.34
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 97.34
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 97.25
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 97.25
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 97.23
COG0411250 LivG ABC-type branched-chain amino acid transport syste 97.22
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 97.22
COG0410237 LivF ABC-type branched-chain amino acid transport syste 97.21
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein 97.19
COG0488530 Uup ATPase components of ABC transporters with duplicat 97.15
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 97.15
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 97.13
pfam04310227 MukB MukB N-terminal. This family represents the N-term 97.12
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 97.1
COG1118345 CysA ABC-type sulfate/molybdate transport systems, ATPa 97.07
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 97.06
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 97.05
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA mismat 97.02
PRK13545549 tagH teichoic acids export protein ATP-binding subunit; 97.02
PRK09984262 phosphonate/organophosphate ester transporter subunit; 98.33
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 98.29
PRK13549513 xylose transporter ATP-binding subunit; Provisional 98.14
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 98.02
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 97.96
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 97.93
COG4618580 ArpD ABC-type protease/lipase transport system, ATPase 97.69
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 97.6
PRK00409 780 recombination and DNA strand exchange inhibitor protein 97.59
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 97.56
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.52
PRK10789569 putative multidrug transporter membrane\ATP-binding com 97.51
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 97.46
PRK10790593 putative multidrug transporter membrane\ATP-binding com 97.44
COG5265497 ATM1 ABC-type transport system involved in Fe-S cluster 97.29
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 97.26
KOG0064728 consensus 97.23
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 97.22
COG3845501 ABC-type uncharacterized transport systems, ATPase comp 97.15
TIGR021691202 SMC_prok_A chromosome segregation protein SMC; InterPro 97.74
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 97.61
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 97.1
KOG0061613 consensus 97.08
PRK10522547 multidrug transporter membrane component/ATP-binding co 97.58
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.49
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 97.43
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 97.18
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 97.08
TIGR03007510 pepcterm_ChnLen polysaccharide chain length determinant 97.52
KOG1029 1118 consensus 97.33
KOG0065 1391 consensus 97.3
pfam00261237 Tropomyosin Tropomyosin. 97.23
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN; InterPro: IPR004604 DNA repair protein RecN is thought to be DNA damage inducible and involved in recombinational processes Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC; InterPro: IPR011890 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>pfam02463 SMC_N RecF/RecN/SMC N terminal domain Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0996 consensus Back     alignment and domain information
>KOG0018 consensus Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit; InterPro: IPR004602 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>KOG0933 consensus Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00611 recf DNA replication and repair protein RecF; InterPro: IPR001238 All proteins in this family, including recF, for which functions are known are DNA binding proteins that assist the filamentation of RecA onto DNA for the initiation of recombination or recombinational repair Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC; InterPro: IPR011890 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information