254781174

254781174

outer membrane assembly lipoprotein YfiO

GeneID in NCBI database:8210199Locus tag:CLIBASIA_05405
Protein GI in NCBI database:254781174Protein Accession:YP_003065587.1
Gene range:-(1173151, 1173966)Protein Length:271aa
Gene description:outer membrane assembly lipoprotein YfiO
COG prediction:[R] DNA uptake lipoprotein
KEGG prediction:outer membrane assembly lipoprotein YfiO; K05807 putative lipoprotein
SEED prediction:Competence lipoprotein comL precursor
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MSAVLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGWERQSSRDVYLDSVTDVRYQREVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQERYPQGYWARYVETLVK
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHc
ccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHcc
MSAVLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGwerqssrdvyldsvtdVRYQREVYEKAVLFLKEQNFSKAYEYFNqcsrdfpfagVARKSLLMSAFVQYSAGKYQQAASLGEEYitqypesknvdYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVErytnspyvkgaRFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQERYPQGYWARYVETLVK
MSAVLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGWerqssrdvyldsvtdvrYQREVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVerytnspyvkGARFYVTvgrnqlaaKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIqerypqgywaRYVETLVK
MSAVLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGWERQSSRDVYLDSVTDVRYQREVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQERYPQGYWARYVETLVK
***VLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGWERQSS********TDVRYQREVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQERYPQGYWAR*VETLVK
MSAVLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGWERQSSRDVYLDSVTDVRYQREVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQERYPQGYWARYVETLVK
*******AICIFEAWAYQLYKFALTIFFSIAVCFLVGWERQSSRDVYLDSVTDVRYQREVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQERYPQGYWARYVETLVK
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAVLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGWERQSSRDVYLDSVTDVRYQREVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQERYPQGYWARYVETLVK
MSAVLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGWERQSSRDVYLDSVTDVRYQREVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQERYPQGYWARYVETLVK
MSAVLGRAICIFEAWAYQLYKFALTIFFSIAVCFLVGWERQSSRDVYLDSVTDVRYQREVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQERYPQGYWARYVETLVK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target271 outer membrane assembly lipoprotein YfiO [Candidatus Li
315122569258 outer membrane assembly lipoprotein YfiO [Candidatus Li 1 2e-79
218659461294 hypothetical protein RetlI_07243 [Rhizobium etli IE4771 1 7e-43
241205546281 outer membrane assembly lipoprotein YfiO [Rhizobium leg 1 2e-42
209550164281 outer membrane assembly lipoprotein YfiO [Rhizobium leg 1 2e-42
190892573289 competence lipoprotein protein [Rhizobium etli CIAT 652 1 2e-42
86358441289 hypothetical protein RHE_CH02838 [Rhizobium etli CFN 42 1 2e-42
116253037289 competence lipoprotein ComL protein [Rhizobium legumino 1 3e-42
218673357248 competence lipoprotein protein [Rhizobium etli GR56] Le 1 4e-42
222086434289 hypothetical protein Arad_2982 [Agrobacterium radiobact 1 2e-41
110634349288 putative lipoprotein [Mesorhizobium sp. BNC1] Length = 1 4e-40
>gi|315122569|ref|YP_004063058.1| outer membrane assembly lipoprotein YfiO [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 258 Back     alignment and organism information
 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 190/255 (74%), Gaps = 2/255 (0%)

Query: 19  LYKFALTIFFSIAVCFLVGWERQS--SRDVYLDSVTDVRYQREVYEKAVLFLKEQNFSKA 76
           +Y+F LTIFF   + FL   + Q+  S++    S++D +YQR +YEKAV  L+ +NF KA
Sbjct: 1   MYRFVLTIFFISTLSFLASCKHQNQPSQNFIFPSISDKKYQRNLYEKAVELLENKNFEKA 60

Query: 77  YEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYL 136
            + F   S++ PF  VARK+LLMSAF +Y   KY  +ASLGEEYI QYP S+++DYVYYL
Sbjct: 61  SKEFYSFSKELPFNDVARKALLMSAFAKYKTKKYLSSASLGEEYIAQYPNSEDIDYVYYL 120

Query: 137 VGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARFYVTVGRNQLAAKEVEI 196
           VGMSYAQ IR+V YDQ  T+ M+QYMS I+E+Y  SPY KGA+FY+++GRNQLA +E+ +
Sbjct: 121 VGMSYAQKIRNVSYDQHPTQSMVQYMSEILEKYPKSPYSKGAQFYLSIGRNQLAGQEMYV 180

Query: 197 GRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLVEAYVALALMDEAREVVSLIQER 256
           GRYYLK  EYV+AI RFQLV+ANY D E  EEAMARLVEAY  L L+DEA  + S+IQ++
Sbjct: 181 GRYYLKNKEYVSAILRFQLVIANYFDTEQVEEAMARLVEAYFMLGLVDEATSMASVIQQK 240

Query: 257 YPQGYWARYVETLVK 271
           YP+G W+ YV  LV+
Sbjct: 241 YPKGLWSDYVSDLVQ 255


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218659461|ref|ZP_03515391.1| hypothetical protein RetlI_07243 [Rhizobium etli IE4771] Length = 294 Back     alignment and organism information
>gi|241205546|ref|YP_002976642.1| outer membrane assembly lipoprotein YfiO [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 281 Back     alignment and organism information
>gi|209550164|ref|YP_002282081.1| outer membrane assembly lipoprotein YfiO [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 281 Back     alignment and organism information
>gi|190892573|ref|YP_001979115.1| competence lipoprotein protein [Rhizobium etli CIAT 652] Length = 289 Back     alignment and organism information
>gi|86358441|ref|YP_470333.1| hypothetical protein RHE_CH02838 [Rhizobium etli CFN 42] Length = 289 Back     alignment and organism information
>gi|116253037|ref|YP_768875.1| competence lipoprotein ComL protein [Rhizobium leguminosarum bv. viciae 3841] Length = 289 Back     alignment and organism information
>gi|218673357|ref|ZP_03523026.1| competence lipoprotein protein [Rhizobium etli GR56] Length = 248 Back     alignment and organism information
>gi|222086434|ref|YP_002544968.1| hypothetical protein Arad_2982 [Agrobacterium radiobacter K84] Length = 289 Back     alignment and organism information
>gi|110634349|ref|YP_674557.1| putative lipoprotein [Mesorhizobium sp. BNC1] Length = 288 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target271 outer membrane assembly lipoprotein YfiO [Candidatus Li
TIGR03302235 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein 8e-50
COG4105254 COG4105, ComL, DNA uptake lipoprotein [General function 3e-40
PRK10866243 PRK10866, PRK10866, outer membrane biogenesis protein B 2e-12
TIGR02795119 TIGR02795, tol_pal_ybgF, tol-pal system protein YbgF 7e-05
COG1729262 COG1729, COG1729, Uncharacterized protein conserved in 0.002
PRK11788389 PRK11788, PRK11788, tetratricopeptide repeat protein; P 0.001
>gnl|CDD|163209 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>gnl|CDD|33862 COG4105, ComL, DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>gnl|CDD|182792 PRK10866, PRK10866, outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>gnl|CDD|131842 TIGR02795, tol_pal_ybgF, tol-pal system protein YbgF Back     alignment and domain information
>gnl|CDD|31915 COG1729, COG1729, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|183314 PRK11788, PRK11788, tetratricopeptide repeat protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 271 outer membrane assembly lipoprotein YfiO [Candidatus Li
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. Membe 100.0
PRK10866243 outer membrane protein assembly complex subunit YfiO; P 100.0
COG4105254 ComL DNA uptake lipoprotein [General function predictio 100.0
TIGR02521247 type_IV_pilW type IV pilus biogenesis/stability protein 99.75
TIGR02917 924 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipop 99.72
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motility and 99.58
PRK11189297 lipoprotein NlpI; Provisional 99.47
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR repe 97.87
KOG1586288 consensus 97.23
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR 99.9
PRK10803262 hypothetical protein; Provisional 99.81
COG1729262 Uncharacterized protein conserved in bacteria [Function 99.68
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.19
cd00189100 TPR Tetratricopeptide repeat domain; typically contains 99.08
CHL00033165 ycf3 photosystem I assembly protein Ycf3 98.83
TIGR02552137 LcrH_SycD type III secretion low calcium response chape 98.83
KOG0543397 consensus 98.71
KOG0553304 consensus 98.42
KOG4234271 consensus 97.97
PRK10747 398 putative protoheme IX biogenesis protein; Provisional 97.87
PRK13184 933 pknD serine/threonine-protein kinase; Reviewed 97.73
KOG4648 536 consensus 97.63
KOG0545329 consensus 97.6
KOG0376 476 consensus 97.28
KOG2053 932 consensus 96.83
KOG0495 913 consensus 96.41
KOG4642284 consensus 95.87
KOG4555175 consensus 94.58
PRK10803262 hypothetical protein; Provisional 99.88
COG1729262 Uncharacterized protein conserved in bacteria [Function 99.84
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR 99.83
KOG3081299 consensus 98.13
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. Membe 99.86
PRK10866243 outer membrane protein assembly complex subunit YfiO; P 99.78
TIGR02917 924 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipop 99.6
TIGR02521247 type_IV_pilW type IV pilus biogenesis/stability protein 98.98
COG4783484 Putative Zn-dependent protease, contains TPR repeats [G 98.8
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motility and 98.48
KOG4340 459 consensus 98.41
PRK10370206 formate-dependent nitrite reductase complex subunit Nrf 98.01
KOG0553304 consensus 97.86
pfam09295395 ChAPs ChAPs (Chs5p-Arf1p-binding proteins). ChAPs (Chs5 97.4
COG4700251 Uncharacterized protein conserved in bacteria containin 97.32
COG4235287 Cytochrome c biogenesis factor [Posttranslational modif 97.2
COG4105254 ComL DNA uptake lipoprotein [General function predictio 99.66
KOG4626 966 consensus 99.26
KOG0547606 consensus 99.04
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.03
KOG1840508 consensus 98.97
KOG1840508 consensus 98.93
COG4783484 Putative Zn-dependent protease, contains TPR repeats [G 98.89
KOG1125579 consensus 98.88
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [General fu 98.82
KOG2003 840 consensus 98.73
PRK11189297 lipoprotein NlpI; Provisional 98.67
PRK10747398 putative protoheme IX biogenesis protein; Provisional 98.64
TIGR00990649 3a0801s09 mitochondrial precursor proteins import recep 98.59
KOG0548 539 consensus 98.45
TIGR00990 649 3a0801s09 mitochondrial precursor proteins import recep 98.37
KOG0550 486 consensus 98.22
PRK10370206 formate-dependent nitrite reductase complex subunit Nrf 98.22
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR repe 98.08
KOG3060289 consensus 98.04
COG4235287 Cytochrome c biogenesis factor [Posttranslational modif 97.98
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [General fu 97.78
KOG1125579 consensus 97.58
PRK12370553 invasion protein regulator; Provisional 97.55
COG3118304 Thioredoxin domain-containing protein [Posttranslationa 97.33
COG4700251 Uncharacterized protein conserved in bacteria containin 96.96
KOG4234271 consensus 96.87
cd05804355 StaR_like StaR_like; a well-conserved protein found in 96.8
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [Coenz 94.89
KOG2610 491 consensus 94.69
PRK11788389 hypothetical protein; Provisional 99.53
COG2956389 Predicted N-acetylglucosaminyl transferase [Carbohydrat 99.43
KOG2002 1018 consensus 99.38
KOG3785 557 consensus 99.21
PRK11447 1158 cellulose synthase subunit BcsC; Provisional 99.18
PRK11788389 hypothetical protein; Provisional 99.17
KOG2002 1018 consensus 99.17
KOG1126638 consensus 99.09
KOG0624 504 consensus 99.08
KOG4626 966 consensus 98.92
KOG3060289 consensus 98.77
pfam04733290 Coatomer_E Coatomer epsilon subunit. This family repres 98.72
KOG1173611 consensus 98.66
KOG1173 611 consensus 98.48
KOG1174564 consensus 98.29
COG2956389 Predicted N-acetylglucosaminyl transferase [Carbohydrat 98.17
KOG2376 652 consensus 98.14
KOG1586288 consensus 98.08
KOG1129478 consensus 97.95
KOG4162 799 consensus 97.79
KOG1129478 consensus 97.75
KOG1174 564 consensus 97.73
COG2976207 Uncharacterized protein conserved in bacteria [Function 97.41
KOG1127 1238 consensus 97.03
COG0457291 NrfG FOG: TPR repeat [General function prediction only] 97.02
KOG1585308 consensus 96.47
PRK11447 1158 cellulose synthase subunit BcsC; Provisional 99.18
KOG1126638 consensus 99.16
KOG1155559 consensus 98.78
KOG1155559 consensus 98.67
KOG1156 700 consensus 98.29
KOG0543397 consensus 98.23
KOG1156 700 consensus 97.62
COG0457291 NrfG FOG: TPR repeat [General function prediction only] 97.42
KOG1130 639 consensus 97.16
KOG0495913 consensus 96.93
PRK10941269 putative transcriptional regulator; Provisional 95.98
pfam04733290 Coatomer_E Coatomer epsilon subunit. This family repres 95.72
KOG3081299 consensus 95.71
pfam03704146 BTAD Bacterial transcriptional activator domain. Found 94.85
KOG0545329 consensus 94.79
COG3629280 DnrI DNA-binding transcriptional activator of the SARP 91.69
KOG0547 606 consensus 98.97
KOG2076 895 consensus 98.73
PRK10049 818 pgaA outer membrane protein PgaA; Provisional 98.68
KOG2376 652 consensus 98.58
PRK10049 818 pgaA outer membrane protein PgaA; Provisional 98.54
KOG2076 895 consensus 98.37
KOG0624 504 consensus 98.23
PRK13184 933 pknD serine/threonine-protein kinase; Reviewed 98.14
KOG3785 557 consensus 98.04
KOG2053 932 consensus 97.99
KOG1130 639 consensus 97.44
KOG4162 799 consensus 97.42
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; Prov 97.29
KOG4340 459 consensus 96.88
KOG0551390 consensus 96.59
PRK11619 645 lytic murein transglycosylase; Provisional 96.06
KOG1128777 consensus 96.01
KOG4642284 consensus 95.52
KOG1127 1238 consensus 95.49
pfam10300446 IML2 Putative mitochondrial outer membrane protein. Thi 95.24
KOG3364149 consensus 95.05
TIGR02561190 HrpB1_HrpK type III secretion protein HrpB1/HrpK; Inter 91.63
KOG4814 872 consensus 90.65
cd00189100 TPR Tetratricopeptide repeat domain; typically contains 98.86
CHL00033165 ycf3 photosystem I assembly protein Ycf3 98.45
KOG0548539 consensus 98.23
TIGR02552137 LcrH_SycD type III secretion low calcium response chape 98.04
pfam10602174 RPN7 26S proteasome subunit RPN7. RPN7 (known as the no 93.7
KOG1941 518 consensus 93.55
KOG2003 840 consensus 98.61
COG5159 421 RPN6 26S proteasome regulatory complex component [Postt 95.03
pfam0051534 TPR_1 Tetratricopeptide repeat. 93.21
pfam0771934 TPR_2 Tetratricopeptide repeat. This Pfam entry include 92.02
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 4 or 91.56
COG2976207 Uncharacterized protein conserved in bacteria [Function 98.22
KOG0550486 consensus 97.81
pfam04781112 DUF627 Protein of unknown function (DUF627). This famil 96.54
PRK12450309 foldase protein PrsA; Reviewed 95.16
PRK01326310 prsA foldase protein PrsA; Reviewed 92.4
TIGR03042142 PS_II_psbQ_bact photosystem II protein PsbQ. This prote 92.12
PRK04405298 prsA peptidylprolyl isomerase; Provisional 91.96
COG3014 449 Uncharacterized protein conserved in bacteria [Function 90.91
PRK03002285 prsA peptidylprolyl isomerase; Reviewed 90.62
pfam0051534 TPR_1 Tetratricopeptide repeat. 94.96
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 4 or 94.0
pfam0771934 TPR_2 Tetratricopeptide repeat. This Pfam entry include 93.67
PRK10941269 putative transcriptional regulator; Provisional 94.21
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266 This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1586 consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR014162 Members of this protein family are the product of one of seven genes regularly clustered in operons to encode the proteins of the tol-pal system, which is critical for maintaining the integrity of the bacterial outer membrane Back     alignment and domain information
>PRK10803 hypothetical protein; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD; InterPro: IPR005415 The type III secretion system of Gram-negative bacteria is used to transport virulence factors from the pathogen directly into the host cell and is only triggered when the bacterium comes into close contact with the host Back     alignment and domain information
>KOG0543 consensus Back     alignment and domain information
>KOG0553 consensus Back     alignment and domain information
>KOG4234 consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG4648 consensus Back     alignment and domain information
>KOG0545 consensus Back     alignment and domain information
>KOG0376 consensus Back     alignment and domain information
>KOG2053 consensus Back     alignment and domain information
>KOG0495 consensus Back     alignment and domain information
>KOG4642 consensus Back     alignment and domain information
>KOG4555 consensus Back     alignment and domain information
>PRK10803 hypothetical protein; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR014162 Members of this protein family are the product of one of seven genes regularly clustered in operons to encode the proteins of the tol-pal system, which is critical for maintaining the integrity of the bacterial outer membrane Back     alignment and domain information
>KOG3081 consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266 This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4340 consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0553 consensus Back     alignment and domain information
>pfam09295 ChAPs ChAPs (Chs5p-Arf1p-binding proteins) Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4626 consensus Back     alignment and domain information
>KOG0547 consensus Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1840 consensus Back     alignment and domain information
>KOG1840 consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1125 consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2003 consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor; InterPro: IPR005687 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents Back     alignment and domain information
>KOG0548 consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor; InterPro: IPR005687 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents Back     alignment and domain information
>KOG0550 consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3060 consensus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1125 consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4234 consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2610 consensus Back     alignment and domain information
>PRK11788 hypothetical protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2002 consensus Back     alignment and domain information
>KOG3785 consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 hypothetical protein; Provisional Back     alignment and domain information
>KOG2002 consensus Back     alignment and domain information
>KOG1126 consensus Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>KOG4626 consensus Back     alignment and domain information
>KOG3060 consensus Back     alignment and domain information
>pfam04733 Coatomer_E Coatomer epsilon subunit Back     alignment and domain information
>KOG1173 consensus Back     alignment and domain information
>KOG1173 consensus Back     alignment and domain information
>KOG1174 consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2376 consensus Back     alignment and domain information
>KOG1586 consensus Back     alignment and domain information
>KOG1129 consensus Back     alignment and domain information
>KOG4162 consensus Back     alignment and domain information
>KOG1129 consensus Back     alignment and domain information
>KOG1174 consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1127 consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1126 consensus Back     alignment and domain information
>KOG1155 consensus Back     alignment and domain information
>KOG1155 consensus Back     alignment and domain information
>KOG1156 consensus Back     alignment and domain information
>KOG0543 consensus Back     alignment and domain information
>KOG1156 consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Back     alignment and domain information
>KOG0495 consensus Back     alignment and domain information
>PRK10941 putative transcriptional regulator; Provisional Back     alignment and domain information
>pfam04733 Coatomer_E Coatomer epsilon subunit Back     alignment and domain information
>KOG3081 consensus Back     alignment and domain information
>pfam03704 BTAD Bacterial transcriptional activator domain Back     alignment and domain information
>KOG0545 consensus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0547 consensus Back     alignment and domain information
>KOG2076 consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2376 consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2076 consensus Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG3785 consensus Back     alignment and domain information
>KOG2053 consensus Back     alignment and domain information
>KOG1130 consensus Back     alignment and domain information
>KOG4162 consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4340 consensus Back     alignment and domain information
>KOG0551 consensus Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG1128 consensus Back     alignment and domain information
>KOG4642 consensus Back     alignment and domain information
>KOG1127 consensus Back     alignment and domain information
>pfam10300 IML2 Putative mitochondrial outer membrane protein Back     alignment and domain information
>KOG3364 consensus Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK; InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4814 consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0548 consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD; InterPro: IPR005415 The type III secretion system of Gram-negative bacteria is used to transport virulence factors from the pathogen directly into the host cell and is only triggered when the bacterium comes into close contact with the host Back     alignment and domain information
>pfam10602 RPN7 26S proteasome subunit RPN7 Back     alignment and domain information
>KOG1941 consensus Back     alignment and domain information
>KOG2003 consensus Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam00515 TPR_1 Tetratricopeptide repeat Back     alignment and domain information
>pfam07719 TPR_2 Tetratricopeptide repeat Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0550 consensus Back     alignment and domain information
>pfam04781 DUF627 Protein of unknown function (DUF627) Back     alignment and domain information
>PRK12450 foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK01326 prsA foldase protein PrsA; Reviewed Back     alignment and domain information
>TIGR03042 PS_II_psbQ_bact photosystem II protein PsbQ Back     alignment and domain information
>PRK04405 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>COG3014 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK03002 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>pfam00515 TPR_1 Tetratricopeptide repeat Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>pfam07719 TPR_2 Tetratricopeptide repeat Back     alignment and domain information
>PRK10941 putative transcriptional regulator; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target271 outer membrane assembly lipoprotein YfiO [Candidatus Li
3qky_A261 Crystal Structure Of Rhodothermus Marinus Bamd Leng 1e-12
>gi|329666231|pdb|3QKY|A Chain A, Crystal Structure Of Rhodothermus Marinus Bamd Length = 261 Back     alignment and structure
 Score = 78.3 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 56/225 (24%), Positives = 88/225 (39%), Gaps = 10/225 (4%)

Query: 55  RYQREVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAA 114
              +E +E+A+ F  +  + +A EYF            A  +    A   Y   +Y  AA
Sbjct: 13  SSPQEAFERAMEFYNQGKYDRAIEYFKAVFTYGRTHEWAADAQFYLARAYYQNKEYLLAA 72

Query: 115 SLGEEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPY 174
           S  E +I  Y     V    Y   M Y ++      DQ  T+  ++     ++RY N   
Sbjct: 73  SEYERFIQIYQIDPRVPQAEYERAMCYYKLSPPYELDQTDTRKAIEAFQLFIDRYPNHEL 132

Query: 175 VKGARFYVTVGRNQLAAKEVEIGRYYLKRGEYVAAIPRFQLVLANYSDAEHAEEAMARLV 234
           V  A   +   R +LA K+ E  R Y +R  Y AA   ++ V   Y D   A++A+   +
Sbjct: 133 VDDATQKIRELRAKLARKQYEAARLYERRELYEAAAVTYEAVFDAYPDTPWADDALVGAM 192

Query: 235 EAYVALALMD----------EAREVVSLIQERYPQGYWARYVETL 269
            AY+A A              A E+   + + +P     R  E L
Sbjct: 193 RAYIAYAEQSVRARQPERYRRAVELYERLLQIFPDSPLLRTAEEL 237


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target271 outer membrane assembly lipoprotein YfiO [Candidatus Li
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal binding; 1e-09
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal binding; 8e-08
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal binding; 0.003
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Length = 129 Back     alignment and structure
 Score = 59.0 bits (143), Expect = 1e-09
 Identities = 21/124 (16%), Positives = 41/124 (33%), Gaps = 8/124 (6%)

Query: 58  REVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLG 117
           R  Y  A   LK   +  A + F      +P       +L       Y+   +Q A +  
Sbjct: 3   RTAYNVAFDALKNGKYDDASQLFLSFLELYPNGVYTPNALYWLGESYYATRNFQLAEAQF 62

Query: 118 EEYITQYPESKNVDYVYYLVGMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKG 177
            + +++YP           +G+S         Y +       Q + ++  +Y  S   + 
Sbjct: 63  RDLVSRYPTHDKAAGGLLKLGLSQ--------YGEGKNTEAQQTLQQVATQYPGSDAARV 114

Query: 178 ARFY 181
           A+  
Sbjct: 115 AQER 118


>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Length = 129 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Length = 129 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target271 outer membrane assembly lipoprotein YfiO [Candidatus Li
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal binding; 99.84
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetratric 99.43
2dba_A148 Smooth muscle cell associated protein-1, isoform 2; tet 99.43
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, OGT, 99.41
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetratricop 99.38
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, bacte 99.34
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, prot 99.33
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotein, te 99.33
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protein; ch 99.33
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, prot 99.28
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; alph 99.28
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1.60 99.27
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, h 99.26
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo 99.22
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, 99.22
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransferase t 99.22
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle 99.19
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, 99.15
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopeptide, 99.15
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransferase t 99.11
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, 99.09
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signa 99.02
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; protei 98.93
3k9i_A117 BH0479 protein; putative protein binding protein, struc 98.93
2e2e_A177 Formate-dependent nitrite reductase complex NRFG subuni 98.92
2hr2_A159 Hypothetical protein; NP_663012.1, structural genomics, 98.88
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricopeptide 98.77
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unknown fu 98.61
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR, tet 98.57
2kat_A115 Uncharacterized protein; NESG, structure, structural ge 98.57
1pc2_A152 Mitochondria fission protein; unknown function; NMR {Ho 98.49
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR motifs 99.78
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mitochond 99.78
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV pilus 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-peptid 99.77
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, protein bi 99.76
2vq2_A225 PILW, putative fimbrial biogenesis and twitching motili 99.74
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillus sub 99.71
2gw1_A514 Mitochondrial precursor proteins import receptor; TPR, 99.7
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltr 99.69
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltr 99.68
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR motifs 99.68
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-peptid 99.67
3hym_B330 Cell division cycle protein 16 homolog; APC, anaphase p 99.65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structural ge 99.64
2gw1_A514 Mitochondrial precursor proteins import receptor; TPR, 99.63
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chaperone 99.63
3hym_B330 Cell division cycle protein 16 homolog; APC, anaphase p 99.62
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, structural 99.6
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, protein bi 99.58
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeats (TP 99.58
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat COAT 99.56
3edt_B283 KLC 2, kinesin light chain 2; superhelical, structural 99.54
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillus sub 99.54
3edt_B283 KLC 2, kinesin light chain 2; superhelical, structural 99.51
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat COAT 99.5
1qqe_A292 Vesicular transport protein SEC17; helix-turn-helix TPR 99.48
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle 99.47
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disassembly, 99.36
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structural ge 99.35
1hz4_A373 MALT regulatory protein; two-helix bundles, helix repea 99.34
3gw4_A203 Uncharacterized protein; structural genomics, PSI-2, pr 99.33
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeats (TP 99.32
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT domain, 99.29
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetratricop 99.25
3dra_A306 Protein farnesyltransferase/geranylgeranyltransferase t 99.24
1qqe_A292 Vesicular transport protein SEC17; helix-turn-helix TPR 99.18
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; protei 99.17
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, OGT, 99.15
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix repea 99.14
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protein; 2. 99.09
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricopeptide 99.05
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT domain, 99.0
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disassembly, 98.93
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT domain, 98.43
1ouv_A273 Conserved hypothetical secreted protein; TPR repeat, HC 98.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT domain, 98.26
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2.60A 97.62
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chaperone 99.76
2vq2_A225 PILW, putative fimbrial biogenesis and twitching motili 99.41
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, tetra 97.87
3pdn_A428 SET and MYND domain-containing protein 3; rossmann fold 97.82
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, alginate bi 97.42
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); alpha-s 97.38
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, alginate bi 97.13
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal binding; 99.74
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, tetratr 93.19
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mitochond 99.63
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protein; 2. 99.17
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated vesi 98.98
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, prot 98.9
2kck_A112 TPR repeat; tetratricopeptide repeat, structural genomi 98.82
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1.55 98.81
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic retic 98.77
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, tetra 98.75
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protein; ch 98.66
3k9i_A117 BH0479 protein; putative protein binding protein, struc 98.64
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alpha, GF 98.58
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, structur 98.51
3dra_A306 Protein farnesyltransferase/geranylgeranyltransferase t 98.51
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Saccharomyce 98.31
2kat_A115 Uncharacterized protein; NESG, structure, structural ge 98.27
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, struc 98.13
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated vesi 98.09
2pqr_A129 Mitochondria fission 1 protein; TPR domain, protein-pro 97.99
3bee_A93 Putative YFRE protein; putaive YFRE protein, structural 97.34
3pdn_A428 SET and MYND domain-containing protein 3; rossmann fold 96.94
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, cyto 95.75
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, cyto 93.56
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV pilus 99.55
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide repe 99.43
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1.60 99.26
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, structural 99.2
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotein, te 99.17
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, prot 98.84
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo 98.8
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, 98.79
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopeptide, 98.72
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, 98.72
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signa 98.66
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unknown fu 98.61
3n71_A490 Histone lysine methyltransferase SMYD1; heart developme 98.42
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, struc 97.61
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide repe 99.43
2e2e_A177 Formate-dependent nitrite reductase complex NRFG subuni 99.18
3n71_A490 Histone lysine methyltransferase SMYD1; heart developme 98.77
3gw4_A203 Uncharacterized protein; structural genomics, PSI-2, pr 98.73
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2.60A 97.34
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetratric 99.17
2dba_A148 Smooth muscle cell associated protein-1, isoform 2; tet 99.03
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, bacte 98.96
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, h 98.92
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; alph 98.92
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, 98.76
2hr2_A159 Hypothetical protein; NP_663012.1, structural genomics, 98.55
1pc2_A152 Mitochondria fission protein; unknown function; NMR {Ho 98.42
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR, tet 98.18
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Saccharomyce 98.43
2kck_A112 TPR repeat; tetratricopeptide repeat, structural genomi 98.39
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1.55 98.33
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic retic 98.2
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, structur 98.08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alpha, GF 98.0
3bee_A93 Putative YFRE protein; putaive YFRE protein, structural 97.2
2pqr_A129 Mitochondria fission 1 protein; TPR domain, protein-pro 97.13
1ouv_A273 Conserved hypothetical secreted protein; TPR repeat, HC 94.52
1w7f_A307 Beta-lactamase; hydrolase, isocitrate, bacillus licheni 91.03
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
Probab=99.84  E-value=1.5e-20  Score=136.74  Aligned_cols=121  Identities=17%  Similarity=0.192  Sum_probs=114.7

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             99999999999809899999999999853047730268998778877654555679999988754011211013555443
Q gi|254781174|r   58 REVYEKAVLFLKEQNFSKAYEYFNQCSRDFPFAGVARKSLLMSAFVQYSAGKYQQAASLGEEYITQYPESKNVDYVYYLV  137 (271)
Q Consensus        58 ~~lY~~a~~~~~~~~y~~A~~~f~~i~~~~P~s~~a~~A~~~la~~~y~~~~y~~A~~~~~~fi~~~P~s~~~~~A~y~~  137 (271)
                      +..|+.|..+++.|+|++|++.|++++..+|.++++++|.+++|.+++.+|+|++|+..|+++++.+|+|+.++.++|.+
T Consensus         3 ~~~Y~~a~~~~~~~~~~~A~~~~~~~i~~~p~~~~~~~a~~~lg~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~a~~~l   82 (129)
T 2xev_A            3 RTAYNVAFDALKNGKYDDASQLFLSFLELYPNGVYTPNALYWLGESYYATRNFQLAEAQFRDLVSRYPTHDKAAGGLLKL   82 (129)
T ss_dssp             CCHHHHHHHHHHTTCHHHHHHHHHHHHHHCSSSTTHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTSTTHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
T ss_conf             99999999999978999999999999988859846899999999999975009999999999998789980689999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             4445555443111234589999999999985200101345655555556
Q gi|254781174|r  138 GMSYAQMIRDVPYDQRATKLMLQYMSRIVERYTNSPYVKGARFYVTVGR  186 (271)
Q Consensus       138 a~~~~~~~~~~~~d~~~~~~A~~~f~~~i~~yP~S~ya~~A~~~l~~~~  186 (271)
                      |.+++.+        +...+|+..|+.+++.||+|+++..|+.+|..++
T Consensus        83 a~~~~~~--------~~~~~A~~~~~~~~~~yP~s~~a~~a~~~L~~l~  123 (129)
T 2xev_A           83 GLSQYGE--------GKNTEAQQTLQQVATQYPGSDAARVAQERLQSIR  123 (129)
T ss_dssp             HHHHHHT--------TCHHHHHHHHHHHHHHSTTSHHHHHHHHHHHHHC
T ss_pred             HHHHHHC--------CCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             9999984--------9999999999999988819999999999999871



>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, cytoplasm, plasmid, virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCNACYLATION; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2vsn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure