peg_1064

peg_1064

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(1134360, 1135076)Protein Length:238aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MGKQRASLAPDPKAIASLQLSANLANASANAYRENIDRMTPDGIWQYKTSGVDKIIDSFIGREISIPHYLQSYSLHPIQQQIHNRQNINNLLLSDLLTQRIQDLLPHHHTHVNTTKDFPPQQLRDNDVPEKPNASLEERKEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKLHNQGLVSGSVAWNRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYFHNLAQAQGLQ
cccccccccccHHHHHHEEEccccccccHHHHHHHHHHccccccEEcccccHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHcccEEcccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHcccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccc
mgkqraslapdpkAIASLQLSANLANASANAYRenidrmtpdgiwqyktsgvdkiidsfigreisiphylqsyslhpiqQQIHNRQNINNLLLSDLLTQRIQDllphhhthvnttkdfppqqlrdndvpekpnasleERKEILynyptmgsqQYEKAFLDRLQSSLQQDREDLETKLhnqglvsgsvAWNRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYFHNLAQAQGLQ
mgkqraslapdpkAIASLQLSANLANASANAYRENIDRMTPDGIWQYKTSGVDKIIDSFIGREISIPHYLQSYSLHPIQQQIHNRQNINNLLLSDLLTQRIQDLLPHHHTHvnttkdfppqqlrdndVPEKPNASLEERKEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKlhnqglvsgsvawnRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYFHNLAQAQGLQ
MGKQRASLAPDPKaiaslqlsanlanasanaYRENIDRMTPDGIWQYKTSGVDKIIDSFIGREISIPHYLQSYSLHPiqqqihnrqninnlllSDLLTQRIQDLLPHHHTHVNTTKDFPPQQLRDNDVPEKPNASLEERKEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKLHNQGLVSGSVAWNRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYFHNLAQAQGLQ
*****************LQLSANLANASANAYRENIDRMTPDGIWQYKTSGVDKIIDSFIGREISIPHYLQSYSLHPIQQQ*HNRQNINNLLLSDLLTQRIQDLLPHHHTHVNTTKDFPPQQLRDNDVPEK*NASLEERKEILYNYPTMGSQQYEKAFLDRLQ******************LVSGSVAWN************************************************
**********DPKAIASLQLSANLANASANAYRENIDRMTPDGIWQYKTSGVDKIIDSFIGREISIPHYLQSYSLHPIQQQIHNRQNINNLLLSDLLTQRIQDLLPHHHTHVNTTKDFPPQQLRDNDVPEKPNASLEERKEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKLHNQGLVSGSVAWNRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYFHNLAQAQGLQ
*******LAPDPKAIASLQLSANLANASANAYRENIDRMTPDGIWQYKTSGVDKIIDSFIGREISIPHYLQSYSLHPIQQQIHNRQNINNLLLSDLLTQRIQDLLPHHHTHVNTTKDFPPQQLRDNDVPEKPNASLEERKEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKLHNQGLVSGSVAWNRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYFHNLAQA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKQRASLAPDPKAIASLQLSANLANASANAYRENIDRMTPDGIWQYKTSGVDKIIDSFIGREISIPHYLQSYSLHPIQQQIHNRQNINNLLLSDLLTQRIQDLLPHHHTHVNTTKDFPPQQLRDNDVPEKPNASLEERKEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKLHNQGLVSGSVAWNRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYFHNLAQAQGLQ
MGKQRASLAPDPKAIASLQLSANLANASANAYRENIDRMTPDGIWQYKTSGVDKIIDSFIGREISIPHYLQSYSLHPIQQQIHNRQNINNLLLSDLLTQRIQDLLPHHHTHVNTTKDFPPQQLRDNDVPEKPNASLEERKEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKLHNQGLVSGSVAWNRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYFHNLAQAQGLQ
MGKQRASLAPDPKAIASLQLSANLANASANAYRENIDRMTPDGIWQYKTSGVDKIIDSFIGREISIPHYLQSYSLHPIQQQIHNRQNINNLLLSDLLTQRIQDLLPHHHTHVNTTKDFPPQQLRDNDVPEKPNASLEERKEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKLHNQGLVSGSVAWNRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYFHNLAQAQGLQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target238
315122526 389 hypothetical protein CKC_03890 [Candidatus Liberibacter 1 3e-67
227822435 453 hypothetical protein NGR_c18900 [Sinorhizobium fredii N 1 4e-25
265985067299 conserved hypothetical protein [Brucella sp. 83/13] Len 1 4e-22
150397020 532 hypothetical protein Smed_1817 [Sinorhizobium medicae W 1 5e-21
316933872 341 hypothetical protein Rpdx1_2530 [Rhodopseudomonas palus 1 0.002
319783503 330 hypothetical protein Mesci_3812 [Mesorhizobium ciceri b 2 1e-28
110632598 322 hypothetical protein Meso_0237 [Mesorhizobium sp. BNC1] 2 6e-19
218673260 334 hypothetical protein RetlG_17541 [Rhizobium etli GR56] 2 1e-18
209548343 334 hypothetical protein Rleg2_0738 [Rhizobium leguminosaru 2 2e-18
327191473 335 hypothetical protein RHECNPAF_300003 [Rhizobium etli CN 2 3e-18
>gi|315122526|ref|YP_004063015.1| hypothetical protein CKC_03890 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 389 Back     alignment and organism information
 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 130/241 (53%), Positives = 174/241 (72%), Gaps = 3/241 (1%)

Query: 1   MGKQRASLAPDPKAIASLQLSANLANASANAYRENIDRMTPDGIWQYKTSGVDKIIDSFI 60
           MGKQ++ L+PDPKA+AS+QLS N+ N+  N+ R N++ +TPDGI +Y   GVDK+ID F 
Sbjct: 1   MGKQQSFLSPDPKAVASMQLSENINNSLFNSSRANMNEITPDGILRYTQEGVDKMIDPFS 60

Query: 61  GREISIPHYLQSYSLHPIQQQIHNRQNINNLLLSDLLTQRIQDLLPH-HHTHVNTTKDFP 119
           G+E+SIP Y +SY L P+ Q ++NR+N N++L S+LLTQR+Q+ +P   +  +N  +   
Sbjct: 61  GQELSIPRYSRSYELSPVAQDLYNRRNANHILFSNLLTQRLQNFMPSPQNNSMNLQQPLA 120

Query: 120 PQQLRDNDVPEKPN--ASLEERKEILYNYPTMGSQQYEKAFLDRLQSSLQQDREDLETKL 177
                 N +PE  N  +  E+ + ILY+Y     QQYE   LDRLQ  L+QDREDLET+L
Sbjct: 121 IPDPAHNPIPEGTNHFSQPEQEEGILYDYGKNNGQQYENTLLDRLQPRLKQDREDLETRL 180

Query: 178 HNQGLVSGSVAWNRAIDETNRKLHDVRLAAMLKASDEQERLDNIQEKHAYFHNLAQAQGL 237
            NQGL+ GSV+WNR IDE NRKL+D RLAA+LK+S+EQERLDN++EK AYFHN AQAQ  
Sbjct: 181 SNQGLMPGSVSWNRTIDENNRKLNDARLAALLKSSEEQERLDNMREKQAYFHNFAQAQSH 240

Query: 238 Q 238
           Q
Sbjct: 241 Q 241


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822435|ref|YP_002826407.1| hypothetical protein NGR_c18900 [Sinorhizobium fredii NGR234] Length = 453 Back     alignment and organism information
>gi|265985067|ref|ZP_06097802.1| conserved hypothetical protein [Brucella sp. 83/13] Length = 299 Back     alignment and organism information
>gi|150397020|ref|YP_001327487.1| hypothetical protein Smed_1817 [Sinorhizobium medicae WSM419] Length = 532 Back     alignment and organism information
>gi|316933872|ref|YP_004108854.1| hypothetical protein Rpdx1_2530 [Rhodopseudomonas palustris DX-1] Length = 341 Back     alignment and organism information
>gi|319783503|ref|YP_004142979.1| hypothetical protein Mesci_3812 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 330 Back     alignment and organism information
>gi|110632598|ref|YP_672806.1| hypothetical protein Meso_0237 [Mesorhizobium sp. BNC1] Length = 322 Back     alignment and organism information
>gi|218673260|ref|ZP_03522929.1| hypothetical protein RetlG_17541 [Rhizobium etli GR56] Length = 334 Back     alignment and organism information
>gi|209548343|ref|YP_002280260.1| hypothetical protein Rleg2_0738 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 334 Back     alignment and organism information
>gi|327191473|gb|EGE58493.1| hypothetical protein RHECNPAF_300003 [Rhizobium etli CNPAF512] Length = 335 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00