254781131

254781131

hypothetical protein CLIBASIA_05165

GeneID in NCBI database:8210156Locus tag:CLIBASIA_05165
Protein GI in NCBI database:254781131Protein Accession:YP_003065544.1
Gene range:-(1133904, 1134356)Protein Length:150aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ
cccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccEEEEEHHHHHHHHcccccEEcccccEEEEEHHHEEcHHHHHHHHHHHccc
ccHHccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHcHcHHHHHHccccHHHHHHccccccEEEEEEEEcccHHHHHHHEEEHHHHHHcccccEEEcccccEEEEccEEEEEcHHEccccccccc
MDQKQQAFHEILSLMqnvtvpklpislnnptpiapidyAGIAQNIYQNQLSERKEGKKEFYDAVNMGyqlaplvsdrrmkcnvkpvanLYQYrylsdpknvqRIGVIAQEiskirpdtvvennqgiksvdygrlfnigqiqtkqkkntaq
MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQlaplvsdrrmKCNVKPVANLYQYrylsdpknvQRIGVIAqeiskirpdtvvennqgiksvdygrlfnigqiqtkqkkntaq
MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ
******A****LS*****************TPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI*************
MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQ*********
****QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTK*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ
MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ
MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target150 hypothetical protein CLIBASIA_05165 [Candidatus Liberib
315122526389 hypothetical protein CKC_03890 [Candidatus Liberibacter 1 2e-44
150397020532 hypothetical protein Smed_1817 [Sinorhizobium medicae W 1 3e-18
227822435453 hypothetical protein NGR_c18900 [Sinorhizobium fredii N 1 2e-13
110632598322 hypothetical protein Meso_0237 [Mesorhizobium sp. BNC1] 1 2e-09
13470675230 hypothetical protein mll0449 [Mesorhizobium loti MAFF30 1 9e-07
149925860 2613 Putative membrane-anchored cell surface protein, haemag 1 7e-06
126443127408 hypothetical protein BURPS668_A2342 [Burkholderia pseud 1 3e-05
167907339399 hypothetical protein BpseN_34235 [Burkholderia pseudoma 1 3e-05
218673260334 hypothetical protein RetlG_17541 [Rhizobium etli GR56] 1 2e-04
327191473335 hypothetical protein RHECNPAF_300003 [Rhizobium etli CN 1 4e-04
>gi|315122526|ref|YP_004063015.1| hypothetical protein CKC_03890 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 389 Back     alignment and organism information
 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/146 (59%), Positives = 113/146 (77%), Gaps = 1/146 (0%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           +DQKQQA HEILSLMQ +   K PI+ NNP  I P+DY  I+QN YQN+  E K+ K+  
Sbjct: 244 IDQKQQALHEILSLMQTIPASKFPITQNNPIAITPVDYREISQNDYQNRFQEWKQRKQNI 303

Query: 61  YDAVNMGYQL-APLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
           YD++N+G +L   ++SDRRMK ++KPV NLYQYRY+SDPK  QRIGV+AQEI+KIRPD V
Sbjct: 304 YDSINIGNKLVGSILSDRRMKRDIKPVGNLYQYRYVSDPKRTQRIGVMAQEINKIRPDAV 363

Query: 120 VENNQGIKSVDYGRLFNIGQIQTKQK 145
           V+N+QG++SVDYG LFN  +I + +K
Sbjct: 364 VKNSQGLQSVDYGLLFNTSKILSPRK 389


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397020|ref|YP_001327487.1| hypothetical protein Smed_1817 [Sinorhizobium medicae WSM419] Length = 532 Back     alignment and organism information
>gi|227822435|ref|YP_002826407.1| hypothetical protein NGR_c18900 [Sinorhizobium fredii NGR234] Length = 453 Back     alignment and organism information
>gi|110632598|ref|YP_672806.1| hypothetical protein Meso_0237 [Mesorhizobium sp. BNC1] Length = 322 Back     alignment and organism information
>gi|13470675|ref|NP_102244.1| hypothetical protein mll0449 [Mesorhizobium loti MAFF303099] Length = 230 Back     alignment and organism information
>gi|149925860|ref|ZP_01914124.1| Putative membrane-anchored cell surface protein, haemagluttinin [Limnobacter sp. MED105] Length = 2613 Back     alignment and organism information
>gi|126443127|ref|YP_001063336.1| hypothetical protein BURPS668_A2342 [Burkholderia pseudomallei 668] Length = 408 Back     alignment and organism information
>gi|167907339|ref|ZP_02494544.1| hypothetical protein BpseN_34235 [Burkholderia pseudomallei NCTC 13177] Length = 399 Back     alignment and organism information
>gi|218673260|ref|ZP_03522929.1| hypothetical protein RetlG_17541 [Rhizobium etli GR56] Length = 334 Back     alignment and organism information
>gi|327191473|gb|EGE58493.1| hypothetical protein RHECNPAF_300003 [Rhizobium etli CNPAF512] Length = 335 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 150 hypothetical protein CLIBASIA_05165 [Candidatus Liberib
KOG3661 1019 consensus 99.4
>KOG3661 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target150 hypothetical protein CLIBASIA_05165 [Candidatus Liberib
3gud_A129 NECK appendage protein; 3-helix bundle, chaperon, chape 99.62
3gw6_A275 Endo-N-acetylneuraminidase; chaperone, glycosidase, hyd 99.59
>3gud_A NECK appendage protein; 3-helix bundle, chaperon, chaperone; HET: PEG; 2.20A {Bacillus phage ga-1} Back     alignment and structure
Probab=99.62  E-value=1.3e-16  Score=109.24  Aligned_cols=75  Identities=24%  Similarity=0.297  Sum_probs=59.5

Q ss_pred             CCHHHCCCCCCCC--------CEEEEEEEECC-------CCCEEEEECHHHHHHHCCCEEEE------------------
Q ss_conf             3513105511245--------32227978718-------98569977567888537801843------------------
Q gi|254781131|r   75 SDRRMKCNVKPVA--------NLYQYRYLSDP-------KNVQRIGVIAQEISKIRPDTVVE------------------  121 (150)
Q Consensus        75 SD~RLK~NI~~I~--------~l~~~~y~~~~-------~~~~~~GvIAQEVe~v~Pe~V~~------------------  121 (150)
                      ||+|||+||+++.        +|++++|+|+.       +...++|||||||++|+|++|..                  
T Consensus         1 SD~RlK~~I~~~~~~~l~~i~~L~p~~f~w~~~~~~~~~~~~~~~G~iAQev~~v~~~~~~~~~~~~~~~~d~~~~~~~~   80 (129)
T 3gud_A            1 SDERHKTDIAPISDKVLDAWEKVKFYQYKFKDAVDEKGEEARYHFGVIAQQIVKVFEDEGLSAFDYGLVGYDEWEATEDE   80 (129)
T ss_dssp             --CCCCCSCCSCCHHHHHHHTTCCCEEECCHHHHHHHGGGSCCEEECCHHHHHHHHHHTTCCGGGGTSEEEEECCCCCCE
T ss_pred             CCHHHCCCCCCCCHHHHHHHHCCCCEEEEEEECCCCCCCCCCEECCCCHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCC
T ss_conf             97644379743980899999728968988654243467777333586354588888761467543114774124345653


Q ss_pred             -----------CC-CCEEEEEHHCHHHHHHHHHHHHHHHC
Q ss_conf             -----------79-84688862023679999998865403
Q gi|254781131|r  122 -----------NN-QGIKSVDYGRLFNIGQIQTKQKKNTA  149 (150)
Q Consensus       122 -----------~~-dg~~~VdY~~L~~l~~~~~~~~~~~~  149 (150)
                                 .+ ..+++|+|.+|+++++.+++++-+.+
T Consensus        81 ~~~e~n~~~~~~~~~~~ygvry~el~~~~~a~l~~~i~~l  120 (129)
T 3gud_A           81 YDSEGNLVEKGREAGNIYSIRPTECQWLEMACMRRKLERL  120 (129)
T ss_dssp             ECSSSCEEECCCCCCEEEEECHHHHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCCCCCCCCEEEECHHHHHHHHHHHHHHHHHHH
T ss_conf             2677752455754541722619999999999999999999



>3gw6_A Endo-N-acetylneuraminidase; chaperone, glycosidase, hydrolase; HET: TAM; 2.60A {Enterobacteria phage K1F} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 150 hypothetical protein CLIBASIA_05165 [Candidatus Li
3gw6_A_109-200_241-275127 (A:109-200,A:241-275) Endo-N-acetylneuraminidase; 4e-09
3gud_A_129 (A:) NECK appendage protein; 3-helix bundle, chape 0.002
>3gw6_A (A:109-200,A:241-275) Endo-N-acetylneuraminidase; chaperone, glycosidase, hydrolase; HET: TAM; 2.60A {Enterobacteria phage K1F}Length = 127 Back     alignment and structure
 Score = 55.4 bits (133), Expect = 4e-09
 Identities = 11/75 (14%), Positives = 23/75 (30%), Gaps = 16/75 (21%)

Query: 75  SDRRMKCNVKPVAN----------LYQYRYLSDPK-----NVQRIGVIAQEISKIRPDTV 119
           ++   K       +             Y++L   +          GVIAQ+I  +     
Sbjct: 14  ANGERKTEPVVFDDAFLDAWGDVHYIMYQWLDAVQLKGNDARIHFGVIAQQIRDVFIAHG 73

Query: 120 VENNQGIKSVDYGRL 134
           +  ++   +  Y  L
Sbjct: 74  LM-DENSTNCRYAVL 87


>3gud_A (A:) NECK appendage protein; 3-helix bundle, chaperon, chaperone; HET: PEG; 2.20A {Bacillus phage ga-1}Length = 129 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target150 hypothetical protein CLIBASIA_05165 [Candidatus Liberib
3gud_A_129 NECK appendage protein; 3-helix bundle, chaperon, 99.68
3gw6_A_109-200_241-275127 Endo-N-acetylneuraminidase; chaperone, glycosidase 99.64
>3gud_A (A:) NECK appendage protein; 3-helix bundle, chaperon, chaperone; HET: PEG; 2.20A {Bacillus phage ga-1} Back     alignment and structure
Probab=99.68  E-value=1e-17  Score=116.10  Aligned_cols=75  Identities=24%  Similarity=0.277  Sum_probs=63.5

Q ss_pred             CCHHHCCCCCCCC--------CEEEEEEEECC-------CCCEEEEECHHHHHHHCCCEEEECC----------------
Q ss_conf             3513105511245--------32227978718-------9856997756788853780184379----------------
Q gi|254781131|r   75 SDRRMKCNVKPVA--------NLYQYRYLSDP-------KNVQRIGVIAQEISKIRPDTVVENN----------------  123 (150)
Q Consensus        75 SD~RLK~NI~~I~--------~l~~~~y~~~~-------~~~~~~GvIAQEVe~v~Pe~V~~~~----------------  123 (150)
                      ||+|||+||+++.        +|++++|.|+.       +..+++|||||||++++|++|..+.                
T Consensus         1 SD~RlK~~I~~i~~~~L~~i~~l~~~~y~~k~~~~~~~~~~~~~~G~IAQe~~~i~p~~v~~~~d~~~~~~~~~~~~~~~   80 (129)
T 3gud_A            1 SDERHKTDIAPISDKVLDAWEKVKFYQYKFKDAVDEKGEEARYHFGVIAQQIVKVFEDEGLSAFDYGLVGYDEWEATEDE   80 (129)
T ss_dssp             --CCCCCSCCSCCHHHHHHHTTCCCEEECCHHHHHHHGGGSCCEEECCHHHHHHHHHHTTCCGGGGTSEEEEECCCCCCE
T ss_pred             CCHHHCCCCCCCCHHHHHHHHCCCCEEEEECCCCCCCCCCCCCEECCCHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCC
T ss_conf             96513479833985899999708968988634433467787513141689998741203777443014750455556664


Q ss_pred             --------------CCEEEEEHHCHHHHHHHHHHHHHHHC
Q ss_conf             --------------84688862023679999998865403
Q gi|254781131|r  124 --------------QGIKSVDYGRLFNIGQIQTKQKKNTA  149 (150)
Q Consensus       124 --------------dg~~~VdY~~L~~l~~~~~~~~~~~~  149 (150)
                                    ...++|+|..|++.++.++++++.-+
T Consensus        81 ~~~~~~~~~~~~~~~~~~~v~~~~l~~~l~~~i~~l~~~i  120 (129)
T 3gud_A           81 YDSEGNLVEKGREAGNIYSIRPTECQWLEMACMRRKLERL  120 (129)
T ss_dssp             ECSSSCEEECCCCCCEEEEECHHHHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             3666761456730200320739999999999999999999



>3gw6_A (A:109-200,A:241-275) Endo-N-acetylneuraminidase; chaperone, glycosidase, hydrolase; HET: TAM; 2.60A {Enterobacteria phage K1F} Back     alignment and structure