peg_1073

peg_1073

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(1138874, 1139362)Protein Length:162aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MTKKAKDGTQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVLIGEGALKVRNEKAVGVVADLFGLSKTT
ccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHccccEEEEEccccccccccEEEEEEEccccccccEEccccHHHHHHHHccccEEEEcHHHHHHHHHHHHHccccccccccccccEEEEEEEEEEEcccccEEEHHHHcccccc
cccccccccEEEHHHHHHHHHHHHHHcccccccEEEEcHHHHHHHHHHcccccHHHHHHHccccccccEEEEEEEEEEccccEEEEEcccHHHcHHHHHHHEEEEcccccEEEEEEHHHccccccccccccccEEEEEEEEEEccHHHHHHHHHHHcccccc
mtkkakdgtqrtFSKQILDEVMQegyqngdnfrhiivSPYVKSEFVRFmsdsnvasfryatsgkshnntivatadiydrpfgkvmvhpnrvmasnaetarnaflidpnmLEFLWLRTIHEdkniakngdankgvligegalkvrneKAVGVVADLFGLSKTT
mtkkakdgtqrtfskqILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRyatsgkshnntivATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHEDKniakngdankGVLIGEgalkvrnekavgvvadlfglsktt
MTKKAKDGTQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVLIGEGALKVRNEKAVGVVADLFGLSKTT
*******GTQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVLIGEGALKVRNEKAVGVVADLFGLS***
***********TFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVLIGEGALKVRNEKAVGVVADLFGLSKTT
*******GTQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVLIGEGALKVRNEKAVGVVADLFGLS***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKKAKDGTQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVLIGEGALKVRNEKAVGVVADLFGLSKTT
MTKKAKDGTQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVLIGEGALKVRNEKAVGVVADLFGLSKTT
MTKKAKDGTQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVLIGEGALKVRNEKAVGVVADLFGLSKTT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target162
315122533331 hypothetical protein CKC_03925 [Candidatus Liberibacter 1 6e-80
227822441331 putative phage major head protein [Sinorhizobium fredii 1 9e-60
150397033331 hypothetical protein Smed_1830 [Sinorhizobium medicae W 1 8e-58
227821704123 putative phage related protein [Sinorhizobium fredii NG 1 1e-39
160897389306 putative phage major head protein [Delftia acidovorans 1 6e-11
221199511317 major head protein [Burkholderia multivorans CGD2M] Len 1 2e-10
291334595316 putative phage major head protein [uncultured phage Med 1 7e-09
288817864291 putative phage major head protein [Hydrogenobacter ther 1 2e-07
283856246304 putative phage major head protein [Zymomonas mobilis su 1 8e-07
163783849291 hypothetical protein HG1285_12862 [Hydrogenivirga sp. 1 1 2e-06
>gi|315122533|ref|YP_004063022.1| hypothetical protein CKC_03925 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 331 Back     alignment and organism information
 Score =  300 bits (767), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 141/161 (87%), Positives = 148/161 (91%)

Query: 1   MTKKAKDGTQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYA 60
           MTKKAKDG QR F+KQ+LD VMQEGYQNG NFRHI+VSPYVKSEFVRFMSDSNVASFRYA
Sbjct: 170 MTKKAKDGAQRPFTKQLLDAVMQEGYQNGANFRHIVVSPYVKSEFVRFMSDSNVASFRYA 229

Query: 61  TSGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHE 120
            S  S NNTIVATADIYD PFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLR I E
Sbjct: 230 VSDNSKNNTIVATADIYDGPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRNIQE 289

Query: 121 DKNIAKNGDANKGVLIGEGALKVRNEKAVGVVADLFGLSKT 161
           DKNIAK GDANKGVLIGEG LKV+NEKA+GV++DLFGLSKT
Sbjct: 290 DKNIAKTGDANKGVLIGEGTLKVKNEKAIGVISDLFGLSKT 330


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822441|ref|YP_002826413.1| putative phage major head protein [Sinorhizobium fredii NGR234] Length = 331 Back     alignment and organism information
>gi|150397033|ref|YP_001327500.1| hypothetical protein Smed_1830 [Sinorhizobium medicae WSM419] Length = 331 Back     alignment and organism information
>gi|227821704|ref|YP_002825674.1| putative phage related protein [Sinorhizobium fredii NGR234] Length = 123 Back     alignment and organism information
>gi|160897389|ref|YP_001562971.1| putative phage major head protein [Delftia acidovorans SPH-1] Length = 306 Back     alignment and organism information
>gi|221199511|ref|ZP_03572555.1| major head protein [Burkholderia multivorans CGD2M] Length = 317 Back     alignment and organism information
>gi|291334595|gb|ADD94245.1| putative phage major head protein [uncultured phage MedDCM-OCT-S04-C136] Length = 316 Back     alignment and organism information
>gi|288817864|ref|YP_003432211.1| putative phage major head protein [Hydrogenobacter thermophilus TK-6] Length = 291 Back     alignment and organism information
>gi|283856246|ref|YP_162122.2| putative phage major head protein [Zymomonas mobilis subsp. mobilis ZM4] Length = 304 Back     alignment and organism information
>gi|163783849|ref|ZP_02178828.1| hypothetical protein HG1285_12862 [Hydrogenivirga sp. 128-5-R1-1] Length = 291 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target162
1ohg_A_282 Major capsid protein; virus, virus coat protein, v 96.21
>1ohg_A (A:) Major capsid protein; virus, virus coat protein, virus/viral protein, auto- catalytic cross-LINK, icosahedral virus; 3.45A {Bacteriophage HK97} Back     alignment and structure
Probab=96.21  E-value=0.091  Score=30.58  Aligned_cols=130  Identities=10%  Similarity=0.006  Sum_probs=88.6

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEECHHHHHHHHHHHCCCCEEEEEECCCCCCCCCEEEEEEEEEECCCEEEE
Q ss_conf             78886531789999999999976998348999499999999861243113454214677655415556789971842679
Q 537021.9.peg.1    6 KDGTQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVM   85 (162)
Q Consensus         6 t~GT~~~lTE~~l~~~lq~i~~~GG~~~~i~v~p~~K~~is~f~~~~~~~~~~~~~~~~~~~~~i~~svd~y~sdfG~v~   85 (162)
                      +.......+.+.+.+++.++..++.++..++++|.....+.++-....++--.  ....+..           ..+-.++
T Consensus       143 ~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~vm~~~~~~~l~~lkd~~g~~l~~--~~~~~~~-----------~~l~G~p  209 (282)
T 1ohg_A          143 SLNATGDTRADIIAHAIYQVTESEFSASGIVLNPRDWHNIALLKDNEGRYIFG--GPQAFTS-----------NIMWGLP  209 (282)
T ss_dssp             GGCCTTCCHHHHHHHHHHHTGGGTSCCCEEEECHHHHHHHHTCBCTTSCBTTT--TTTSCCC-----------SEETTEE
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHEECCCCCEEEC--CCCCCCC-----------CEECCEE
T ss_conf             11235654146799999867644566755998053644565212689966531--3455776-----------4035703


Q ss_pred             EEECCCCCCCCCCCEEEEEECHHHEEEEECCCCCEECCCCCCC------CCEEEEEEEEEEEEEECHHHCEEEEC
Q ss_conf             9825656887644205999846454531027642000136678------82267999998758708000689974
Q 537021.9.peg.1   86 VHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHEDKNIAKNG------DANKGVLIGEGALKVRNEKAVGVVAD  154 (162)
Q Consensus        86 ivpnr~~~~~~~~~~~~~ilD~~~~~~~~Lr~~~~~e~laktG------D~~k~~i~~E~tL~~~n~~a~g~I~d  154 (162)
                      |+.+..||.+     ++++.|+....+-+.|.-...+ ....+      +.....+...+...+.+|+|..++..
T Consensus       210 V~~~~~~~~~-----~~~~gd~~~~~~~~~~~~~~v~-~~~~~~~~~~~~~~~~~~~~~~d~~v~~~~a~~~~~~  278 (282)
T 1ohg_A          210 VVPTKAQAAG-----TFTVGGFDMASQVWDRMDATVE-VSREDRDNFVKNMLTILCEERLALAHYRPTAIIKGTF  278 (282)
T ss_dssp             EEECTTSCTT-----EEEEECHHHHEEEEESEEEEEE-EESSSTTCTTTTEEEEEEEEEECEEESCGGGEEEEEC
T ss_pred             EEECCCCCCC-----EEEEEECCCEEEEEEECCCEEE-EECCCCHHHHCCEEEEEEEEEEEEEEECCCEEEEEEE
T ss_conf             7871788766-----0688504441799991240899-9505410655890999999998437706882999998