peg_1087

peg_1087

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(1148295, 1148441)Protein Length:48aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
  
--------10--------20--------30--------40--------
MKTKVMVHPNRVMASNAETARNAFLIHPKWILLSPNNVMAPLNLFLFL
ccEEEEEccccEEEccccccccEEEEccEEEEEcccccEEEEEEEEEc
cccEEEEccccHHcccHHHHHHHHHHcccEEEEcccccccccHHHHcc
mktkvmvhpnrvmasnAETARNAFLihpkwillspnnvmapLNLFLFL
mktkvmvhpnrvMASNAETARNAFLIHPkwillspnnVMAPLNLFLFL
MKTKVMVHPNRVMASNAETARNAFLIHPKWILLSPNNVMAPLNLFLFL
****V***PNRVMASNAETARNAFLIHPKWILLSPNNVMAPLNLFLFL
MKTKVMVHPNRVMASNAETARNAFLIHPKWILLSPNNVMAPLNLFLFL
**TKVMVHPNRVMASNAETARNAFLIHPKWILLSPNNVMAPLNLFLFL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooo
MKTKVMVHPNRVMASNAETARNAFLIHPKWILLSPNNVMAPLNLFLFL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target48
315122533331 hypothetical protein CKC_03925 [Candidatus Liberibacter 1 6e-06
>gi|315122533|ref|YP_004063022.1| hypothetical protein CKC_03925 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 331 Back     alignment and organism information
 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 24/25 (96%), Positives = 24/25 (96%)

Query: 4   KVMVHPNRVMASNAETARNAFLIHP 28
           KVMVHPNRVMASNAETARNAFLI P
Sbjct: 252 KVMVHPNRVMASNAETARNAFLIDP 276


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00