254781150

254781150

hypothetical protein CLIBASIA_05285

GeneID in NCBI database:8210175Locus tag:CLIBASIA_05285
Protein GI in NCBI database:254781150Protein Accession:YP_003065563.1
Gene range:+(1148381, 1148482)Protein Length:33aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30---
MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKEW
ccEEEEEccccccEEEEEEEEccHHHHHccccc
ccEEEEEcccccEEEEEEEEccccEEEEccccc
MDFIVakqrngpiesvslfvdmpysvikdgkew
mdfivakqrngpiesvslfvdmpysvikdgkew
MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKEW
*DFI***QRNGPIESVSLFVDMPYSVIKD****
MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKEW
MDFIVAKQRNGPIESVSLFVDMPYSVIKDG***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooo
iiiihhhhhhhhhhhhhhhhhhhhooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKEW

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target33 hypothetical protein CLIBASIA_05285 [Candidatus Liberib
315122540475 replicative DNA helicase [Candidatus Liberibacter solan 1 2e-10
>gi|315122540|ref|YP_004063029.1| replicative DNA helicase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 475 Back     alignment and organism information
 Score = 68.6 bits (166), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/32 (90%), Positives = 31/32 (96%)

Query: 1   MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKE 32
           MDFI+AKQRNGPIESVSLF DMPYS+IKDGKE
Sbjct: 444 MDFIIAKQRNGPIESVSLFADMPYSIIKDGKE 475


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target33 hypothetical protein CLIBASIA_05285 [Candidatus Liberib
TIGR00665434 TIGR00665, DnaB, replicative DNA helicase 0.004
>gnl|CDD|161985 TIGR00665, DnaB, replicative DNA helicase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 33 hypothetical protein CLIBASIA_05285 [Candidatus Liberib
PRK07773868 replicative DNA helicase; Validated 96.76
COG0305435 DnaB Replicative DNA helicase [DNA replication, recombi 95.23
PRK08506473 replicative DNA helicase; Provisional 94.86
PRK09165484 replicative DNA helicase; Provisional 93.93
PRK08760476 replicative DNA helicase; Provisional 93.5
PRK06904472 replicative DNA helicase; Validated 93.36
PRK07263453 consensus 93.15
PRK05636507 replicative DNA helicase; Provisional 93.06
PRK08082453 consensus 92.94
PRK08840464 replicative DNA helicase; Provisional 92.78
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 92.72
PRK08694468 consensus 92.6
PRK05748448 replicative DNA helicase; Provisional 92.55
PRK05595444 replicative DNA helicase; Provisional 92.47
PRK06321472 replicative DNA helicase; Provisional 92.32
PRK08006471 replicative DNA helicase; Provisional 92.32
PRK07004460 replicative DNA helicase; Provisional 92.1
PRK06749428 replicative DNA helicase; Provisional 90.39
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK07263 consensus Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08082 consensus Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK08694 consensus Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00