peg_410

peg_410

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(430717, 433575)Protein Length:952aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:FIG061771: ATP-dependent nuclease subunit A
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950--
LKNRFGLSLNESYELIYKDLWPLPYFQVSDINKYVSLSMETGNPTILKKAQTLQQASQTQCIEERFSLLSSFFLTQKFTPQKNIITQEINKKSPDLKEKLKKSQDEFIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDFFVGKNTHSSPRTLFAVGDEKQSIYSFHGAEPKRVLREKRINQKRATNAGQKFSIIELPLSFRSTADILTVVDKVFSIPENAQGLSEDSTTTIRHRSSRIGQVGTVQLWEQVVSQHDSQCNPQQESWTSYFDSLPQESSASILARRIAYTISNMIGTDTIFSNGKKRVIQAKDILVLVRKRKDTPLITFLTRFLKNDYKISVVGNDRFILTDHLAIKDLMALGRFILSQEDDLSFVCMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTLRNEQNSYSSLQELISELEQYPPTIKRAHSANHNEVRIMTVHTAKGLESPVVFLVDTGSQVFSHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNNIVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLIICKHSNTSNEKKSNQRTWYDMVYDSFHNDERVKKIKLTNSINKDEWIAYEWSTHHPENTPLEREETIKQLMDEQKIPKKLFSPIKNDINEPYILNPSTIDTKGKTNLESLLSDNQTFNRGLIIHKLLQVIFTLPEHKRKNFITSYCTKNAKLWPAKEYKNLLLSITRLLENPMMTTAMSCDSYSEVSVSGKINCPKKDIIISGRIDQISISQQNIFIFEYKTHHHVPQEIEHIPYTHIAQLSIYEKILKDSYPNKSLVCLLIYVSEPKVFIIPQNKLNKAFAEISTKIP
ccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHcccccccccccccEEEEEcccccccccccccHHHHHHHHHHHcHHccccccccEEEEcccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHEEHHHHccccHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHccccccccEEEEEccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccccccHHHHHHHHHHccccccccccccccccHHcccccccccccccccccccccccHHcccccccHHHHHHHHHcccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHccccccccccccccccccccEEEEEEEEEEEEEccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccEEEccHHHHHHHHHHHccccc
ccHHccccccccHHHHHHHHccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHcccccccccccEEEEEccccEEEEEccccHHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHcccccccccHcccccccHHHHHccccccEEcccccccccHcccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHcccccEEEEEEHHHHccccEEEEEEcccEcEcccEccccccccHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccccccccccccHHHHHHHHHHcccccccHHHcccccccccccHHHHcccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHccccccEEEEEEEcccccccEEEEEEEEEEEEcccEEEEEEccccccccccHHHcHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccccccHHHHHHHHHHHccccc
lknrfglslnESYELIykdlwplpyfqvsdiNKYVSLSMETGNPTILKKAQTLQQASQTQCIEERFSLLSSFfltqkftpqkniitqeinkkspDLKEKLKKSQDEFIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDffvgknthssprtlfavgdekqsiysfhgaepkrVLREKRINQkratnagqkfsiielplsfrstaDILTVVDKVfsipenaqglsedsttTIRHrssrigqvgTVQLWEQVVSQhdsqcnpqqeswtsyfdslpqessASILARRIAYTISnmigtdtifsngkkrviQAKDILVLVRKRKDTPLITFLTRFLkndykisvvgndrfilTDHLAIKDLMALGRFILSQEDDLSFVCMlksplfnfseddiFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIaqfcsphdfFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTLRNEQNSYSSLQELISELeqypptikrahsanhneVRIMTVHTakglespvvflvdtgsqvfshkHIKKMhimpslnddpgipiwipqsksrnNIVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLIICkhsntsnekksnqrtwYDMVYDSFhndervkkikltnsinkdeWIAYEwsthhpentpleREETIKQLMDEQkipkklfspikndinepyilnpstidtkgktNLESLLSDNQTFNRGLIIHKLLQVIFtlpehkrknfitsyctknaklwpakEYKNLLLSITRLlenpmmttamscdsysevsvsgkincpkkdiiisgridqisisQQNIFIFEykthhhvpqeiehipythiAQLSIYEKILkdsypnksLVCLLIYvsepkvfiipqnKLNKAFAEISTKIP
lknrfglsLNESYELIYKDLWPLPYFQVSDINKYVSLSMETGNPTILKKAQTLQQASQTQCIEERFSLLSSFFLTQKftpqkniitqeinkkspdlkekLKKSQDEFIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINtndllkkrdVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDFfvgknthssprtlfavgdekqsiysfhgaepkrvlrekrinqkratnagqkfsiielplsfrSTADILTVVDKVFsipenaqglsedstttirhRSSRIGQVGTVQLWEQVVSQHDSQCNPQQESWTSYFDSLPQESSASILARRIAYTISNMIGtdtifsngkkrviQAKDilvlvrkrkdtplitfltrflkndykisvVGNDRFILTDHLAIKDLMALGRFILSQEDDLSFVCMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTLRNEQNSYSSLQELISELEQYPPTIKRAHSANHNEVRIMTVHTAKGLESPVVFLVDTGSQVFSHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNNIVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLIICKhsntsnekksnqrtWYDMVYDSfhndervkkikltnsinkDEWIAYEWsthhpentplEREETIKQLMDEQKIPKKlfspikndinepyilnpstiDTKGKTNLESLLSDNQTFNRGLIIHKLLQVIFTLpehkrknfitsyctknaklwpakEYKNLLLSITRLLENPMMTTAMSCDSYSEVSVSGKINCPKKDIIISGRIDQISISQQNIFIFEYKTHHHVPQEIEHIPYTHIAQLSIYEKILKDSYPNKSLVCLLIYVSEPKVFIIPQNKLNKAFaeistkip
LKNRFGLSLNESYELIYKDLWPLPYFQVSDINKYVSLSMETGNPTILKKAQTLQQASQTQCIEERFSLLSSFFLTQKFTPQKNIITQEINkkspdlkeklkksQDEFIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDFFVGKNTHSSPRTLFAVGDEKQSIYSFHGAEPKRVLREKRINQKRATNAGQKFSIIELPLSFRSTADILTVVDKVFSIPENAQGLSEDSTTTIRHRSSRIGQVGTVQLWEQVVSQHDSQCNPQQESWTSYFDSLPQESSASILARRIAYTISNMIGTDTIFSNGKKRVIQAKDILVLVRKRKDTPLITFLTRFLKNDYKISVVGNDRFILTDHLAIKDLMALGRFILSQEDDLSFVCMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTLRNEQNSYSSLQELISELEQYPPTIKRAHSANHNEVRIMTVHTAKGLESPVVFLVDTGSQVFSHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNNIVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLIICKHSNTSNEKKSNQRTWYDMVYDSFHNDERVKKIKLTNSINKDEWIAYEWSTHHPENTPLEREETIKQLMDEQKIPKKLFSPIKNDINEPYILNPSTIDTKGKTNLESLLSDNQTFNRGLIIHKLLQVIFTLPEHKRKNFITSYCTKNAKLWPAKEYKNLLLSITRLLENPMMTTAMSCDSYSEVSVSGKINCPKKDiiisgridqisisqqnififEYKTHHHVPQEIEHIPYTHIAQLSIYEKILKDSYPNKSLVCLLIYVSEPKVFIIPQNKLNKAFAEISTKIP
LKNRFGLSLNESYELIYKDLWPLPYFQVSDINKYVSLSMETGNPTILKKAQTLQQASQTQCIEERFSLLSSFFLTQKFTP******QEINKKSPDLKEKLKKSQDEFIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDFFVGKNTHSSPRTLFAVGDEKQSIYSFHGAEPKRVLREKRINQKRATNAGQKFSIIELPLSFRSTADILTVVDKVFSIPENAQGLSEDSTTTIRHRSSRIGQVGTVQLWEQVVS**********************ESSASILARRIAYTISNMIGTDTIFSNGKKRVIQAKDILVLVRKRKDTPLITFLTRFLKNDYKISVVGNDRFILTDHLAIKDLMALGRFILSQEDDLSFVCMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTLRNEQNSYSSLQELISEL*******************IMTVHTAKGLESPVVFLVDTGSQV*********HIMPSLNDDPGIPIWIPQSKSRNNIVSDLIKHL***TQEEYNRLLYVGMTRASDQLIICKHSNTS****SNQRTWYDMVYDSFHNDERVKKIKLTNSINKDEWIAYEWSTHHP**************MDEQKIPKKLFSPIKNDI****************************FNRGLIIHKLLQVIFTLPEHKRKNFITSYCTKNAKLWPAKEYKNLLLSITRLLENPMMTTAMSCDSYSEVSVSGKINCPKKDIIISGRIDQISISQQNIFIFEYKTHHHVPQEIEHIPYTHIAQLSIYEKILKDSYPNKSLVCLLIYVSEPKVFIIPQNKLNKAFAEIS****
LKNRFGLSLNESYELIYKDLWPLPYFQVSDINKYVSLSMETGNPTILKK**********QCIEERFSLLSSFFLTQKFTPQKNIITQEINKKSPDLKEKLKKSQDEFIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDFFVGKNTHSSPRTLFAVGDEKQSIYSFHGAEPKRVLREKRINQKRATNAGQKFSIIELPLSFRSTADILTVVDKVFSIPENA*************RSSRIGQVGTVQLWEQVV*************WTSYFDSLPQESSASILARRIAYTISNMIGTDTIFSNGKKRVIQAKDILVLVRKRKDTPLITFLTRFLKNDYKISVVGNDRFILTDHLAIKDLMALGRFILSQEDDLSFVCMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTLRNEQNSYSSLQELISELEQYPPTIKRAHSANHNEVRIMTVHTAKGLESPVVFLVDTGSQVFSHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNNIVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLIICKHSNTSNEKKSNQRTWYDMVYDSFHNDERVKKIKLTNSINKDEWIAYEWSTHHPENTPLEREETIKQLMDEQKIPKKLFSPIKNDINEPYILNPSTIDTKGKTNLESLLSDNQTFNRGLIIHKLLQVIFTLPEHKRKNFITSYCTKNAKLWPAKEYKNLLLSITRLLENPMMTTAMSCDSYSEVSVSGKINCPKKDIIISGRIDQISISQQNIFIFEYKTHHHVPQEIEHIPYTHIAQLSIYEKILKDSYPNKSLVCLLIYVSEPKVFIIPQNKLNKAFAEISTKIP
*K**FGLSLNESYELIYKDLWPLPYFQVSDINKYVSLSMETGNPTILKKAQTLQQASQTQCIEERFSLLSSFFLTQKFTPQKNIITQEINKKSPDLKEKLKKSQDEFIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDFFVGKNTHSSPRTLFAVGDEKQSIYSFHGAEPKRVLREKRINQKRATNAGQKFSIIELPLSFRSTADILTVVDKVFSIPENAQGLSEDSTTTIRHRSSRIGQVGTVQLWEQVVSQ***********WTSYFDSLPQESSASILARRIAYTISNMIGTDTIFSNGKKRVIQAKDILVLVRKRKDTPLITFLTRFLKNDYKISVVGNDRFILTDHLAIKDLMALGRFILSQEDDLSFVCMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTLRNEQNSYSSLQELISELEQYPPTIKRAHSANHNEVRIMTVHTAKGLESPVVFLVDTGSQVFSHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNNIVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLIICKHSNTSNEKKSNQRTWYDMVYDSFHNDERVKKIKLTNSINKDEWIAYEWSTHHPE***************EQKIPKKLFSPIKNDINEPYILNP*******KTNLESLLSDNQTFNRGLIIHKLLQVIFTLPEHKRKNFITSYCTKNAKLWPAKEYKNLLLSITRLLENPMMTTAMSCDSYSEVSVSGKINCPKKDIIISGRIDQISISQQNIFIFEYKTHHHVPQEIEHIPYTHIAQLSIYEKILKDSYPNKSLVCLLIYVSEPKVFIIPQNKLNKAFAEIS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LKNRFGLSLNESYELIYKDLWPLPYFQVSDINKYVSLSMETGNPTILKKAQTLQQASQTQCIEERFSLLSSFFLTQKFTPQKNIITQEINKKSPDLKEKLKKSQDEFIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDFFVGKNTHSSPRTLFAVGDEKQSIYSFHGAEPKRVLREKRINQKRATNAGQKFSIIELPLSFRSTADILTVVDKVFSIPENAQGLSEDSTTTIRHRSSRIGQVGTVQLWEQVVSQHDSQCNPQQESWTSYFDSLPQESSASILARRIAYTISNMIGTDTIFSNGKKRVIQAKDILVLVRKRKDTPLITFLTRFLKNDYKISVVGNDRFILTDHLAIKDLMALGRFILSQEDDLSFVCMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTxxxxxxxxxxxxxxxxxxxxxPPTIKRAHSANHNEVRIMTVHTAKGLESPVVFLVDTGSQVFSHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNNIVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLIICKHSNTSNEKKSNQRTWYDMVYDSFHNDERVKKIKLTNSINKDEWIAYEWSTHHPENTPLEREETIKQLMDEQKIPKKLFSPIKNDINEPYILNPSTIDTKGKTNLESLLSDNQTFNRGLIIHKLLQVIFTLPEHKRKNFITSYCTKNAKLWPAKEYKNLLLSITRLLENPMMTTAMSCDSYSEVSVSGKINCPKKDIIISGRIDQISISQQNIFIFEYKTHHHVPQEIEHIPYTHIAQLSIYEKILKDSYPNKSLVCLLIYVSEPKVFIIPQNKLNKAFAEISTKIP
LKNRFGLSLNESYELIYKDLWPLPYFQVSDINKYVSLSMETGNPTILKKAQTLQQASQTQCIEERFSLLSSFFLTQKFTPQKNIITQEINKKSPDLKEKLKKSQDEFIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDFFVGKNTHSSPRTLFAVGDEKQSIYSFHGAEPKRVLREKRINQKRATNAGQKFSIIELPLSFRSTADILTVVDKVFSIPENAQGLSEDSTTTIRHRSSRIGQVGTVQLWEQVVSQHDSQCNPQQESWTSYFDSLPQESSASILARRIAYTISNMIGTDTIFSNGKKRVIQAKDILVLVRKRKDTPLITFLTRFLKNDYKISVVGNDRFILTDHLAIKDLMALGRFILSQEDDLSFVCMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTLRNEQNSYSSLQELISELEQYPPTIKRAHSANHNEVRIMTVHTAKGLESPVVFLVDTGSQVFSHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNNIVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLIICKHSNTSNEKKSNQRTWYDMVYDSFHNDERVKKIKLTNSINKDEWIAYEWSTHHPENTPLEREETIKQLMDEQKIPKKLFSPIKNDINEPYILNPSTIDTKGKTNLESLLSDNQTFNRGLIIHKLLQVIFTLPEHKRKNFITSYCTKNAKLWPAKEYKNLLLSITRLLENPMMTTAMSCDSYSEVSVSGKINCPKKDIIISGRIDQISISQQNIFIFEYKTHHHVPQEIEHIPYTHIAQLSIYEKILKDSYPNKSLVCLLIYVSEPKVFIIPQNKLNKAFAEISTKIP
LKNRFGLSLNESYELIYKDLWPLPYFQVSDINKYVSLSMETGNPTILKKAQTLQQASQTQCIEERFSLLSSFFLTQKFTPQKNIITQEINKKSPDLKEKLKKSQDEFIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDFFVGKNTHSSPRTLFAVGDEKQSIYSFHGAEPKRVLREKRINQKRATNAGQKFSIIELPLSFRSTADILTVVDKVFSIPENAQGLSEDSTTTIRHRSSRIGQVGTVQLWEQVVSQHDSQCNPQQESWTSYFDSLPQESSASILARRIAYTISNMIGTDTIFSNGKKRVIQAKDILVLVRKRKDTPLITFLTRFLKNDYKISVVGNDRFILTDHLAIKDLMALGRFILSQEDDLSFVCMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTLRNEQNSYSSLQELISELEQYPPTIKRAHSANHNEVRIMTVHTAKGLESPVVFLVDTGSQVFSHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNNIVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLIICKHSNTSNEKKSNQRTWYDMVYDSFHNDERVKKIKLTNSINKDEWIAYEWSTHHPENTPLEREETIKQLMDEQKIPKKLFSPIKNDINEPYILNPSTIDTKGKTNLESLLSDNQTFNRGLIIHKLLQVIFTLPEHKRKNFITSYCTKNAKLWPAKEYKNLLLSITRLLENPMMTTAMSCDSYSEVSVSGKINCPKKDIIISGRIDQISISQQNIFIFEYKTHHHVPQEIEHIPYTHIAQLSIYEKILKDSYPNKSLVCLLIYVSEPKVFIIPQNKLNKAFAEISTKIP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target952
254780952685 DNA helicase II [Candidatus Liberibacter asiaticus 7e-08
254780952685 DNA helicase II [Candidatus Liberibacter asiaticus 0.001
>gi|254780952|ref|YP_003065365.1| DNA helicase II [Candidatus Liberibacter asiaticus str. psy62] Length = 685 Back     alignment
 Score = 51.2 bits (121), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 69/139 (49%), Gaps = 19/139 (13%)

Query: 141 KKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLT 200
           K K+C  DF  LII T ++L    V      K  ++I +I++DE QD +  Q+ ++R L 
Sbjct: 203 KTKSC--DFGGLIIKTIEVLHHPHVLK----KYHEKIPYIMVDEYQDINTPQYLLLRLLC 256

Query: 201 EDFFVGKNTHSSPRTLFAVGDEKQSIYSFHGAEPKRVLREKRINQKRATNAGQKFSIIEL 260
           +     K        +  VGDE Q IY + GA+   +L      QK   +A    +II+L
Sbjct: 257 Q-----KEDSKQGARICCVGDENQCIYEWRGAQFSHILN----FQKDFKDA----NIIKL 303

Query: 261 PLSFRSTADILTVVDKVFS 279
             ++RST  IL   +K+ S
Sbjct: 304 EQNYRSTTHILNTANKLIS 322

>gi|254780952|ref|YP_003065365.1| DNA helicase II [Candidatus Liberibacter asiaticus str. psy62] Length = 685 Back     alignment
 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 102/245 (41%), Gaps = 37/245 (15%)

Query: 375 DILVLVRKRKDTPLITFLTRFLKNDYKISVVGNDRFILTDHLAIKDLMALGRFILSQEDD 434
           +I +LVR    T    F   FL+ +    V+G   +   D   I+D +A  R +  +  D
Sbjct: 375 NIAILVRTSWQTR--KFEDAFLEQEIPHKVIGGSFY---DRQEIRDALAYFRLVCQEHRD 429

Query: 435 LSFVCMLKSPLFNFSEDDIFKICTQRHETE---TVYEYIQKFANCGISK------FQHVI 485
             F  ++  P     ++ + KI  Q H ++   ++ +  +K  + G  +       Q+ +
Sbjct: 430 EDFKRIINCPKRGIGKESLHKI--QYHASQHHISLLQASEKLIDSGQFRPQIRQSLQNFV 487

Query: 486 KYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISRFGN--------EVIDVLDEFLNFTL 537
           K I    + ++   P     +IL     +  +++ + N        E +D L E L+   
Sbjct: 488 KDIRRWNNCSKKMDPAPIANMILE----QSGYMAMWKNNKSSEKSQERLDNLRELLSIIE 543

Query: 538 RNEQNSYSSLQELISE-LEQYPPTIKRAHSANHNEVRIMTVHTAKGLESPVVFLVDTGSQ 596
           ++E      LQ  + E L  + P        + N ++IMT+H AKGLE   VF+      
Sbjct: 544 KHETLEGFVLQAPLRENLGSFIP--------DSNCIQIMTLHAAKGLEFDTVFISGWEQG 595

Query: 597 VFSHK 601
           +  H+
Sbjct: 596 LLPHQ 600

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target952
3151220461179 double-strand break repair helicase AddA [Candidatus Li 1 0.0
1162497921183 ATP-dependent UvrD family DNA helicase [Rhizobium legum 1 0.0
2412069691183 double-strand break repair helicase AddA [Rhizobium leg 1 0.0
2220842271188 double-strand break repair helicase AddA [Agrobacterium 1 0.0
2095515301183 double-strand break repair helicase AddA [Rhizobium leg 1 0.0
863556941183 nuclease/helicase protein, ATP dependent [Rhizobium etl 1 0.0
2221470621182 ATP-dependant DNA helicase [Agrobacterium vitis S4] Len 1 0.0
1908896661183 probable ATP-dependent exonuclease V protein, nuclease 1 0.0
3271927941183 putative ATP-dependent exonuclease V protein [Rhizobium 1 0.0
3252914761185 ATP-dependent DNA helicase [Agrobacterium sp. H13-3] Le 1 0.0
>gi|315122046|ref|YP_004062535.1| double-strand break repair helicase AddA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1179 Back     alignment and organism information
 Score = 1285 bits (3325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/953 (66%), Positives = 763/953 (80%), Gaps = 11/953 (1%)

Query: 1    LKNRFGLSLNESYELIYKDLWPLPYFQVSDINKYVSLSMETGNPTILKKAQTLQQASQTQ 60
            LK+RF L  NESYE IY+D+WPLP+ + SDI +Y+ L+       +LKKA  L++ SQ  
Sbjct: 235  LKDRFDLPPNESYEKIYQDMWPLPHLRESDIKQYIFLAT---TKKMLKKANILKKLSQDH 291

Query: 61   CIEERFSLLSSFFLTQKFTP--QKNIITQEINKKSPDLKEKLKKSQDEFIKIRDRFNTYK 118
             IEER +LL SFFLT++F P     ++T    KK PDLKEK+ KSQ EFI I +R  TYK
Sbjct: 292  SIEERLNLLLSFFLTEEFKPYTHTTMMTASAAKKLPDLKEKIIKSQQEFILIWERLKTYK 351

Query: 119  MFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEIN 178
            +F +TLASLTLAK+LN HY++ KKKN  LDFEDLI+ T DLLKKRD+SAWIRYKIDQEIN
Sbjct: 352  IFSTTLASLTLAKHLNFHYDKLKKKNFFLDFEDLIVYTVDLLKKRDISAWIRYKIDQEIN 411

Query: 179  HILIDEVQDTSLIQWEVIRSLTEDFFVGKNTHSSPRTLFAVGDEKQSIYSFHGAEPKRVL 238
            HILIDEVQDTSL QWE+IRSLTEDFF+G N +S+PRTLFAVGDEKQSI+SFHGAEPKR  
Sbjct: 412  HILIDEVQDTSLSQWEIIRSLTEDFFIGGNVYSNPRTLFAVGDEKQSIFSFHGAEPKRFF 471

Query: 239  REKRINQKRATNAGQKFSIIELPLSFRSTADILTVVDKVFSIPENAQGLSEDSTTTIRHR 298
             EK IN++R  +AGQKFS I+LPLSFRST +IL  VDKVFS  ENAQGL+ED    I HR
Sbjct: 472  HEKTINKERIISAGQKFSTIQLPLSFRSTPEILAAVDKVFSTSENAQGLTEDKQQ-ILHR 530

Query: 299  SSRIGQVGTVQLWEQVVSQHDSQCNPQQESWTSYFDSLPQESSASILARRIAYTISNMIG 358
            S+RIG  G VQLWE+V+S+     NP+QE W S FDS+P+E+SASILARRIAYTIS MI 
Sbjct: 531  SNRIGHAGNVQLWEKVISKP----NPKQEDWISCFDSVPEETSASILARRIAYTISKMIR 586

Query: 359  TDTIFSNGKKRVIQAKDILVLVRKRKDTPLITFLTRFLKNDYKISVVGNDRFILTDHLAI 418
            +DTI +NGKKR + AKDIL+LVRKRK+ P I FLTRFL ND+KISV  NDRF+LTDHLAI
Sbjct: 587  SDTIINNGKKRPVHAKDILILVRKRKNNPFIAFLTRFLINDHKISVASNDRFVLTDHLAI 646

Query: 419  KDLMALGRFILSQEDDLSFVCMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGI 478
            KDLMALG FI+SQEDDLS V +LKSP+FN SE+DIF+ICT+RHETET+Y YIQK AN GI
Sbjct: 647  KDLMALGNFIISQEDDLSLVSLLKSPIFNLSENDIFEICTKRHETETIYAYIQKLANHGI 706

Query: 479  SKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTLR 538
            SK  H+++Y+ ELI I Q CSP+DFFTLILGAK+GR+QFISRFG EV+DVL+EFLNFTLR
Sbjct: 707  SKCCHIVQYMQELICIYQSCSPYDFFTLILGAKEGRKQFISRFGIEVVDVLNEFLNFTLR 766

Query: 539  NEQNSYSSLQELISELEQYPPTIKRAHSANHNEVRIMTVHTAKGLESPVVFLVDTGSQVF 598
            NEQ + S+LQEL+S+LE YPPT+K+  S N NEVRIMTVH+AKGLESPVVFLVDTGS+VF
Sbjct: 767  NEQKNCSTLQELMSDLEHYPPTLKK-ESVNRNEVRIMTVHSAKGLESPVVFLVDTGSEVF 825

Query: 599  SHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNNIVSDLIKHLKKSTQEEYNRLLYVGMTRA 658
            S  HIKK+HI PS +D PG PIWIPQ   RN IVSDLI+ LKKS QEE NRLLYVGMTRA
Sbjct: 826  SSNHIKKIHISPSSDDCPGTPIWIPQQFLRNKIVSDLIQDLKKSAQEENNRLLYVGMTRA 885

Query: 659  SDQLIICKHSNTSNEKKSNQRTWYDMVYDSFHNDERVKKIKLTNSINKDEWIAYEWSTHH 718
            SD+LIIC HSN SNE KSNQRTWY+MVY+SF+ D +VK++KL N  NKDEW+AYEW   +
Sbjct: 886  SDKLIICSHSNASNENKSNQRTWYNMVYESFYEDTQVKEVKLKNPTNKDEWLAYEWCLPN 945

Query: 719  PENTPLEREETIKQLMDEQKIPKKLFSPIKNDINEPYILNPSTIDTKGKTNLESLLSDNQ 778
             EN  +E E        E+KIP+KLF+PIKN++   Y+LNPS ++ K K   E LL DN 
Sbjct: 946  TENIQVEEEAITAPSNREEKIPEKLFAPIKNEMETSYVLNPSMLNLKDKAIPEKLLPDNT 1005

Query: 779  TFNRGLIIHKLLQVIFTLPEHKRKNFITSYCTKNAKLWPAKEYKNLLLSITRLLENPMMT 838
               RG IIH+LLQVIFTLPE KR  +I SYC KNA     +E  NLL+SI  LL++P+M+
Sbjct: 1006 CLKRGQIIHQLLQVIFTLPEEKRDPYILSYCKKNANFLSVEEDNNLLISIKALLKDPIMS 1065

Query: 839  TAMSCDSYSEVSVSGKINCPKKDIIISGRIDQISISQQNIFIFEYKTHHHVPQEIEHIPY 898
            TAMS DSY+EVSVSGKI+  KKD++ISGRIDQI+ISQ+N+FIFEYKTH  +P+ IE+IP 
Sbjct: 1066 TAMSSDSYAEVSVSGKIHLSKKDVLISGRIDQIAISQKNVFIFEYKTHPLLPKGIEYIPS 1125

Query: 899  THIAQLSIYEKILKDSYPNKSLVCLLIYVSEPKVFIIPQNKLNKAFAEISTKI 951
            +HI QL+IYEK+LK+ YP+KS++CLLIY+S PK+F+IPQ KL+++F EI  KI
Sbjct: 1126 SHITQLAIYEKVLKNLYPDKSIICLLIYISGPKIFMIPQEKLDQSFMEIEDKI 1178


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116249792|ref|YP_765630.1| ATP-dependent UvrD family DNA helicase [Rhizobium leguminosarum bv. viciae 3841] Length = 1183 Back     alignment and organism information
>gi|241206969|ref|YP_002978065.1| double-strand break repair helicase AddA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 1183 Back     alignment and organism information
>gi|222084227|ref|YP_002542753.1| double-strand break repair helicase AddA [Agrobacterium radiobacter K84] Length = 1188 Back     alignment and organism information
>gi|209551530|ref|YP_002283447.1| double-strand break repair helicase AddA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 1183 Back     alignment and organism information
>gi|86355694|ref|YP_467586.1| nuclease/helicase protein, ATP dependent [Rhizobium etli CFN 42] Length = 1183 Back     alignment and organism information
>gi|222147062|ref|YP_002548019.1| ATP-dependant DNA helicase [Agrobacterium vitis S4] Length = 1182 Back     alignment and organism information
>gi|190889666|ref|YP_001976208.1| probable ATP-dependent exonuclease V protein, nuclease and helicase domains [Rhizobium etli CIAT 652] Length = 1183 Back     alignment and organism information
>gi|327192794|gb|EGE59722.1| putative ATP-dependent exonuclease V protein [Rhizobium etli CNPAF512] Length = 1183 Back     alignment and organism information
>gi|325291476|ref|YP_004277340.1| ATP-dependent DNA helicase [Agrobacterium sp. H13-3] Length = 1185 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target952
TIGR027841141 TIGR02784, addA_alphas, double-strand break repair heli 0.0
COG0210655 COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA 3e-39
TIGR01073726 TIGR01073, pcrA, ATP-dependent DNA helicase PcrA 4e-35
TIGR006091087 TIGR00609, recB, exodeoxyribonuclease V, beta subunit 1e-28
TIGR01074664 TIGR01074, rep, ATP-dependent DNA helicase Rep 5e-20
TIGR01075715 TIGR01075, uvrD, DNA helicase II 4e-18
TIGR027851232 TIGR02785, addA_Gpos, recombination helicase AddA, Firm 1e-32
pfam00580494 pfam00580, UvrD-helicase, UvrD/REP helicase 4e-31
PRK13909910 PRK13909, PRK13909, putative recombination protein RecB 8e-17
PRK13909910 PRK13909, PRK13909, putative recombination protein RecB 4e-16
PRK11773721 PRK11773, uvrD, DNA-dependent helicase II; Provisional 8e-11
PRK10919672 PRK10919, PRK10919, ATP-dependent DNA helicase Rep; Pro 6e-10
PRK11054684 PRK11054, helD, DNA helicase IV; Provisional 1e-09
PRK11773721 PRK11773, uvrD, DNA-dependent helicase II; Provisional 3e-08
PRK10919672 PRK10919, PRK10919, ATP-dependent DNA helicase Rep; Pro 0.001
COG10741139 COG1074, RecB, ATP-dependent exoDNAse (exonuclease V) b 1e-102
>gnl|CDD|163018 TIGR02784, addA_alphas, double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>gnl|CDD|30559 COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|162191 TIGR01073, pcrA, ATP-dependent DNA helicase PcrA Back     alignment and domain information
>gnl|CDD|161956 TIGR00609, recB, exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>gnl|CDD|130146 TIGR01074, rep, ATP-dependent DNA helicase Rep Back     alignment and domain information
>gnl|CDD|130147 TIGR01075, uvrD, DNA helicase II Back     alignment and domain information
>gnl|CDD|163019 TIGR02785, addA_Gpos, recombination helicase AddA, Firmicutes type Back     alignment and domain information
>gnl|CDD|144246 pfam00580, UvrD-helicase, UvrD/REP helicase Back     alignment and domain information
>gnl|CDD|184388 PRK13909, PRK13909, putative recombination protein RecB; Provisional Back     alignment and domain information
>gnl|CDD|184388 PRK13909, PRK13909, putative recombination protein RecB; Provisional Back     alignment and domain information
>gnl|CDD|183307 PRK11773, uvrD, DNA-dependent helicase II; Provisional Back     alignment and domain information
>gnl|CDD|182838 PRK10919, PRK10919, ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>gnl|CDD|182930 PRK11054, helD, DNA helicase IV; Provisional Back     alignment and domain information
>gnl|CDD|183307 PRK11773, uvrD, DNA-dependent helicase II; Provisional Back     alignment and domain information
>gnl|CDD|182838 PRK10919, PRK10919, ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>gnl|CDD|31272 COG1074, RecB, ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 952
TIGR027841190 addA_alphas double-strand break repair helicase AddA; I 100.0
TIGR027851295 addA_Gpos recombination helicase AddA; InterPro: IPR014 100.0
COG10741139 RecB ATP-dependent exoDNAse (exonuclease V) beta subuni 100.0
PRK108761181 recB exonuclease V subunit beta; Provisional 100.0
PRK13909911 putative recombination protein RecB; Provisional 100.0
TIGR006091324 recB exodeoxyribonuclease V, beta subunit; InterPro: IP 100.0
TIGR02773 1192 addB_Gpos ATP-dependent nuclease subunit B; InterPro: I 100.0
COG3857 1108 AddB ATP-dependent nuclease, subunit B [DNA replication 99.97
TIGR03623874 probable DNA repair protein. Members of this protein fa 99.97
TIGR027861096 addB_alphas double-strand break repair protein AddB; In 99.88
TIGR01073811 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR0057 100.0
PRK11773722 uvrD DNA-dependent helicase II; Provisional 100.0
TIGR01074677 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 100.0
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 100.0
TIGR01075741 uvrD DNA helicase II; InterPro: IPR005753 The SOS respo 100.0
COG0210655 UvrD Superfamily I DNA and RNA helicases [DNA replicati 100.0
KOG2108853 consensus 99.94
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 100.0
PRK11054684 helD DNA helicase IV; Provisional 100.0
TIGR01447753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 98.14
TIGR02774 1116 rexB_recomb ATP-dependent nuclease subunit B; InterPro: 99.67
pfam042571008 Exonuc_V_gamma Exodeoxyribonuclease V, gamma subunit. T 99.64
PRK11069 1122 recC exonuclease V subunit gamma; Provisional 99.62
COG13301078 RecC Exonuclease V gamma subunit [DNA replication, reco 98.73
COG3893697 Inactivated superfamily I helicase [DNA replication, re 98.17
COG3973747 Superfamily I DNA and RNA helicases [General function p 99.59
KOG2108853 consensus 99.29
COG3972660 Superfamily I DNA and RNA helicases [General function p 99.23
KOG1803649 consensus 98.23
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 96.36
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 96.05
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 91.26
COG2887269 RecB family exonuclease [DNA replication, recombination 98.97
pfam10926 363 DUF2800 Protein of unknown function (DUF2800). This is 98.78
pfam09810 329 Morph_protein1 Defects in morphology protein 1, mitocho 98.35
PRK09709877 exonuclease VIII; Reviewed 97.72
pfam06023290 DUF911 Archaeal protein of unknown function (DUF911). T 97.61
PRK10875607 recD exonuclease V subunit alpha; Provisional 98.46
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 98.44
COG0507696 RecD ATP-dependent exoDNAse (exonuclease V), alpha subu 98.25
KOG1802935 consensus 96.88
KOG1803649 consensus 95.74
TIGR01447753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 95.58
pfam01443226 Viral_helicase1 Viral (Superfamily 1) RNA helicase. Hel 94.18
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 93.45
TIGR00372206 cas4 CRISPR-associated protein Cas4; InterPro: IPR01334 98.11
pfam01930162 Cas_Cas4 Domain of unknown function DUF83. This domain 98.09
PHA01622204 CRISPR-associated Cas4-like protein 97.54
PHA00619210 CRISPR-associated Cas4-like protein 96.74
COG1468190 CRISPR-associated protein Cas4 (RecB family exonuclease 95.82
COG4343281 CRISPR-associated protein, RecB family exonuclease [Def 95.1
pfam01939228 DUF91 Protein of unknown function DUF91. The function o 94.08
COG1637253 Predicted nuclease of the RecB family [DNA replication, 92.87
PRK04247250 hypothetical protein; Provisional 92.81
PRK03298224 hypothetical protein; Provisional 92.72
pfam08011101 DUF1703 Protein of unknown function (DUF1703). This fam 90.83
KOG18051100 consensus 98.08
KOG1805 1100 consensus 97.34
COG1112767 Superfamily I DNA and RNA helicases and helicase subuni 96.47
PRK138261102 Dtr system oriT relaxase; Provisional 96.22
PRK13889992 conjugal transfer relaxase TraA; Provisional 96.11
PRK10875607 recD exonuclease V subunit alpha; Provisional 93.44
pfam01443226 Viral_helicase1 Viral (Superfamily 1) RNA helicase. Hel 97.13
PRK10536262 hypothetical protein; Provisional 96.1
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 95.14
KOG18071025 consensus 96.76
TIGR03491457 RecB family nuclease, putative, TM0106 family. Members 96.44
KOG1804775 consensus 93.51
COG1112767 Superfamily I DNA and RNA helicases and helicase subuni 92.61
TIGR02768888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 96.3
pfam06250320 DUF1016 Protein of unknown function (DUF1016). Family o 94.47
COG2251474 Predicted nuclease (RecB family) [General function pred 94.14
>TIGR02784 addA_alphas double-strand break repair helicase AddA; InterPro: IPR014151 AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA; InterPro: IPR014152 AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit; InterPro: IPR004586 Exodeoxyribonuclease V, or RecBCD holoenzyme, (3 Back     alignment and domain information
>TIGR02773 addB_Gpos ATP-dependent nuclease subunit B; InterPro: IPR014140 DNA repair is accomplished by several different systems in prokaryotes Back     alignment and domain information
>COG3857 AddB ATP-dependent nuclease, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03623 probable DNA repair protein Back     alignment and domain information
>TIGR02786 addB_alphas double-strand break repair protein AddB; InterPro: IPR014153 AddAB is a system well described in the Firmicutes as a replacement for RecBCD in many prokaryotes for the repair of double stranded break DNA damage Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR005751 The DNA helicase PcrA is found mainly in Gram-positive bacteria and belongs to a superfamily of helicases, together with Rep and UvrD helicases from Escherichia coli Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 RepA hexameric DNA helicase contain ATP-binding domains similar to those seen in monomeric helicases but which are arranged in a ring Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II; InterPro: IPR005753 The SOS response is required for efficient nucleotide excision repair (NER) of the major ultraviolet light (UV) induced DNA lesions Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2108 consensus Back     alignment and domain information
>pfam00580 UvrD-helicase UvrD/REP helicase Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344 This family describes the exodeoxyribonuclease V alpha subunit, RecD Back     alignment and domain information
>TIGR02774 rexB_recomb ATP-dependent nuclease subunit B; InterPro: IPR014141 DNA repair is accomplished by several different systems in prokaryotes Back     alignment and domain information
>pfam04257 Exonuc_V_gamma Exodeoxyribonuclease V, gamma subunit Back     alignment and domain information
>PRK11069 recC exonuclease V subunit gamma; Provisional Back     alignment and domain information
>COG1330 RecC Exonuclease V gamma subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3893 Inactivated superfamily I helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG2108 consensus Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG1803 consensus Back     alignment and domain information
>pfam02562 PhoH PhoH-like protein Back     alignment and domain information
>pfam09848 DUF2075 Uncharacterized conserved protein (DUF2075) Back     alignment and domain information
>pfam03969 AFG1_ATPase AFG1-like ATPase Back     alignment and domain information
>COG2887 RecB family exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam10926 DUF2800 Protein of unknown function (DUF2800) Back     alignment and domain information
>pfam09810 Morph_protein1 Defects in morphology protein 1, mitochondrial precursor Back     alignment and domain information
>PRK09709 exonuclease VIII; Reviewed Back     alignment and domain information
>pfam06023 DUF911 Archaeal protein of unknown function (DUF911) Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345 These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1802 consensus Back     alignment and domain information
>KOG1803 consensus Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344 This family describes the exodeoxyribonuclease V alpha subunit, RecD Back     alignment and domain information
>pfam01443 Viral_helicase1 Viral (Superfamily 1) RNA helicase Back     alignment and domain information
>pfam09848 DUF2075 Uncharacterized conserved protein (DUF2075) Back     alignment and domain information
>TIGR00372 cas4 CRISPR-associated protein Cas4; InterPro: IPR013343 This entry consists of conserved proteins found in many prokaryotic genomes whose genes are associated with CRISPRs (Clustered, Regularly Interspaced Short Palidromic Repeats) Back     alignment and domain information
>pfam01930 Cas_Cas4 Domain of unknown function DUF83 Back     alignment and domain information
>PHA01622 CRISPR-associated Cas4-like protein Back     alignment and domain information
>PHA00619 CRISPR-associated Cas4-like protein Back     alignment and domain information
>COG1468 CRISPR-associated protein Cas4 (RecB family exonuclease) [Defense mechanisms] Back     alignment and domain information
>COG4343 CRISPR-associated protein, RecB family exonuclease [Defense mechanisms] Back     alignment and domain information
>pfam01939 DUF91 Protein of unknown function DUF91 Back     alignment and domain information
>COG1637 Predicted nuclease of the RecB family [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04247 hypothetical protein; Provisional Back     alignment and domain information
>PRK03298 hypothetical protein; Provisional Back     alignment and domain information
>pfam08011 DUF1703 Protein of unknown function (DUF1703) Back     alignment and domain information
>KOG1805 consensus Back     alignment and domain information
>KOG1805 consensus Back     alignment and domain information
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>pfam01443 Viral_helicase1 Viral (Superfamily 1) RNA helicase Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>pfam05970 DUF889 PIF1 helicase Back     alignment and domain information
>KOG1807 consensus Back     alignment and domain information
>TIGR03491 RecB family nuclease, putative, TM0106 family Back     alignment and domain information
>KOG1804 consensus Back     alignment and domain information
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136 This entry represents the Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>pfam06250 DUF1016 Protein of unknown function (DUF1016) Back     alignment and domain information
>COG2251 Predicted nuclease (RecB family) [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target952
3pjr_A724 Helicase Substrate Complex Length = 724 3e-80
2is1_A680 Crystal Structure Of Uvrd-Dna-So4 Complex Length = 3e-72
3lfu_A647 Crystal Structure Of E. Coli Uvrd Length = 647 3e-71
1w36_B1180 Recbcd:dna Complex Length = 1180 5e-72
2pjr_A548 Helicase Product Complex Length = 548 4e-67
1uaa_A673 E. Coli Rep HelicaseDNA COMPLEX Length = 673 4e-62
1qhh_B273 Structure Of Dna Helicase With Adpnp Length = 273 5e-52
gi|4930230|pdb|3PJR|A Chain A, Helicase Substrate Complex Length = 724 Back     alignment and structure
 Score =  305 bits (780), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 117/695 (16%), Positives = 225/695 (32%), Gaps = 137/695 (19%)

Query: 6   GLSLNESYELIYKDLWPLPYFQVSDINKYVSLSMETGNPTILKKAQTLQQASQTQCIEER 65
           G    ++  L ++  + +    V+  N             + ++ Q+L   +        
Sbjct: 32  GAGSGKTRVLTHRIAYLMAEKHVAPWNILAITFTNKAAREMRERVQSLLGGAAEDVWIST 91

Query: 66  FSLLSSFFLTQKFTP-------------------QKNIITQEINKKSPDLKEKLKKSQDE 106
           F  +    L +                       +  +  + I+ K  + +  L      
Sbjct: 92  FHSMCVRILRRDIDRIGINRNFSILDPTDQLSVMKTILKEKNIDPKKFEPRTILGTISAA 151

Query: 107 FIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVS 166
             ++       K  +++     +   +   Y++   +N  LDF+DLI+ T  L  +    
Sbjct: 152 KNELLPPEQFAK--RASTYYEKVVSDVYQEYQQRLLRNHSLDFDDLIMTTIQLFDR---V 206

Query: 167 AWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDFFVGKNTHSSPRTLFAVGDEKQSI 226
             + +    +  +I IDE QDT+  Q+ +++ L E F          + + AVGD  QSI
Sbjct: 207 PDVLHYYQYKFQYIHIDEYQDTNRAQYTLVKKLAERF----------QNICAVGDADQSI 256

Query: 227 YSFHGAEPKRVLREKRINQKRATNAGQKFSIIELPLSFRSTADILTVVDKVFSIPENAQG 286
           Y + GA+ + +L  +R              +I L  ++RST  IL   ++V     N + 
Sbjct: 257 YRWRGADIQNILSFERDYPN--------AKVILLEQNYRSTKRILQAANEVIEHNVNRKP 308

Query: 287 LSEDSTTTIRHRSSRIGQVGTVQLWEQVVSQHDSQCNPQQESWTSYFDSLPQESSASILA 346
                                                 +   +    +   +       A
Sbjct: 309 KRIW----------------------------TENPEGKPILYYEAMNEADE-------A 333

Query: 347 RRIAYTISNMIGTDTIFSNGKKRVIQAKDILVLVRKRKDTPLITFLTRFLKNDYKISVVG 406
           + +A  I   +              + +D  VL R    + ++  +         I    
Sbjct: 334 QFVAGRIREAVERGER---------RYRDFAVLYRTNAQSRVMEEML----LKANIPYQI 380

Query: 407 NDRFILTDHLAIKDLMALGRFILSQEDDLSFVCMLKSPLFNFSEDDIFKI-CTQRHETET 465
                  D   IKD++A  R I + +DDLS + ++  P        I K+         +
Sbjct: 381 VGGLKFYDRKEIKDILAYLRVIANPDDDLSLLRIINVPKRGIGASTIDKLVRYAADHELS 440

Query: 466 VYEYIQKFAN-----CGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQFISR 520
           ++E + +                    + +   + ++ S  +    +L     R+   + 
Sbjct: 441 LFEALGELEMIGLGAKAAGALAAFRSQLEQWTQLQEYVSVTELVEEVLDKSGYREMLKAE 500

Query: 521 FGNEVI---DVLDEFLNFTLRNEQ-NSYSSLQELISELEQY---PPTIKRAHSANHNEVR 573
              E     + LDEFL+ T   E  +   SL   +++L              +A  + V 
Sbjct: 501 RTIEAQSRLENLDEFLSVTKHFENVSDDKSLIAFLTDLALISDLDELDGTEQAAEGDAVM 560

Query: 574 IMTVHTAKGLESPVVFLVDTGSQVFSHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNNIVS 633
           +MT+H AKGLE PVVFL+     +F H    +                            
Sbjct: 561 LMTLHAAKGLEFPVVFLIGMEEGIFPHNRSLEDDDEMEEE-------------------- 600

Query: 634 DLIKHLKKSTQEEYNRLLYVGMTRASDQLIICKHS 668
                          RL YVG+TRA ++L++    
Sbjct: 601 --------------RRLAYVGITRAEEELVLTSAQ 621


>gi|126030797|pdb|2IS1|A Chain A, Crystal Structure Of Uvrd-Dna-So4 Complex Length = 680 Back     alignment and structure
>gi|321159776|pdb|3LFU|A Chain A, Crystal Structure Of E. Coli Uvrd Length = 647 Back     alignment and structure
gi|56966626|pdb|1W36|B Chain B, Recbcd:dna Complex Length = 1180 Back     alignment and structure
>gi|9257172|pdb|2PJR|A Chain A, Helicase Product Complex Length = 548 Back     alignment and structure
>gi|3318688|pdb|1UAA|A Chain A, E. Coli Rep HelicaseDNA COMPLEX Length = 673 Back     alignment and structure
>gi|5542369|pdb|1QHH|B Chain B, Structure Of Dna Helicase With Adpnp Length = 273 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target952
1w36_B1180 RECB, exodeoxyribonuclease V beta chain; recombination, 2e-40
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, helica 2e-35
2is6_A680 DNA helicase II; hydrolase/DNA complex; HET: DNA ADP; 2 4e-32
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase REP.) 4e-25
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombination 3e-05
1w36_C 1122 RECC, exodeoxyribonuclease V gamma chain; recombination 5e-05
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Length = 1180 Back     alignment and structure
 Score =  163 bits (412), Expect = 2e-40
 Identities = 129/873 (14%), Positives = 278/873 (31%), Gaps = 114/873 (13%)

Query: 96   LKEKLKKSQDEFIKIRDRFNTYKMFKSTLASLTLAKYLNAHYEEAKKKNCVLDFEDLIIN 155
             K   +  +    +  D+     +    L        +       K++   L F+D++  
Sbjct: 298  TKAGGETPRHPLFEAIDQLLAEPLSIRDLVITRALAEIRETVAREKRRRGELGFDDMLSR 357

Query: 156  TNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDFFVGKNTHSSPRT 215
             +    + +    +   I       +IDE QDT   Q+ + R +          H     
Sbjct: 358  LDSA-LRSESGEVLAAAIRTRFPVAMIDEFQDTDPQQYRIFRRIWH--------HQPETA 408

Query: 216  LFAVGDEKQSIYSFHGAEPKRVLREKRINQKRATNAGQKFSIIELPLSFRSTADILTVVD 275
            L  +GD KQ+IY+F GA+    ++ +                  L  ++RS   ++  V+
Sbjct: 409  LLLIGDPKQAIYAFRGADIFTYMKARSEVHAH----------YTLDTNWRSAPGMVNSVN 458

Query: 276  KVFSIPENAQGLSEDSTTTIRHRSSRIGQVGTVQLWEQVVSQHDSQCNPQQESWTSYFDS 335
            K+FS  ++A    E     ++               + +      +  P  + W    +S
Sbjct: 459  KLFSQTDDAFMFREIPFIPVKSAGK----------NQALRFVFKGETQPAMKMWLMEGES 508

Query: 336  LPQESSASILARRIAYTISNMI-----GTDTIFSNGKKRVIQAKDILVLVRKRKDTPLIT 390
                   S +A+  A  I + +     G   + +    R ++A DI VLVR R++   + 
Sbjct: 509  CGVGDYQSTMAQVCAAQIRDWLQAGQRGEALLMNGDDARPVRASDISVLVRSRQEAAQVR 568

Query: 391  FLTRFLKNDYKISVVGNDRFILTDHLAIKDLMALGRFILSQEDDLSFVCMLKSPLFNFSE 450
                 L+      V  ++R  + + L  ++++ L + +++ E + +    L + +   + 
Sbjct: 569  DALTLLEIPS---VYLSNRDSVFETLEAQEMLWLLQAVMTPERENTLRSALATSMMGLNA 625

Query: 451  DDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGA 510
             DI  +    H  + V E    +          + +    +  +    S  +    +L  
Sbjct: 626  LDIETLNNDEHAWDVVVEEFDGYRQ--------IWRKRGVMPMLRALMSARNIAENLLAT 677

Query: 511  KKGRQQFISRFGNEVIDVLDEFLNFTLRNEQNSYSSLQELISELEQYPPTIKRAHSANHN 570
              G ++         I  L +     L +E      L + I E +    + +    ++ +
Sbjct: 678  AGGERRLTDI---LHISELLQEAGTQLESEHALVRWLSQHILEPDSNASSQQMRLESDKH 734

Query: 571  EVRIMTVHTAKGLESPVVFLVDTGSQVFSHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNN 630
             V+I+T+H +KGLE P+V+L    +     +           +D       +       N
Sbjct: 735  LVQIVTIHKSKGLEYPLVWLPFITNFRVQEQAF--------YHDRHSFEAVLD-----LN 781

Query: 631  IVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLII--CKHSNTSNEKKSNQRTWYDMVYDS 688
               + +   +     E  RLLYV +TR+     +          +KK +       +   
Sbjct: 782  AAPESVDLAEAERLAEDLRLLYVALTRSVWHCSLGVAPLVRRRGDKKGDTDVHQSALGRL 841

Query: 689  FHNDERVKKIKLTNSINKDEWIAYEWSTHH-PENTPLEREETIKQLMDEQKIPKKLFSPI 747
                E      L   I         W T    +N P +  +     ++ + + +      
Sbjct: 842  LQKGEPQDAAGLRTCIEALCDDDIAWQTAQTGDNQPWQVNDVSTAELNAKTLQRLPGDNW 901

Query: 748  K-----------NDINEPYILNPSTIDTKGKTNLESLLSDNQTF----NRGLIIHKLLQV 792
            +           + I +  +           + +E        F    + G  +H L + 
Sbjct: 902  RVTSYSGLQQRGHGIAQDLMPRLDVDAAGVASVVEEPTLTPHQFPRGASPGTFLHSLFED 961

Query: 793  I-FTLPEHKR-----------------------KNFITSYCTKNAKLWPAKEYKNLLLSI 828
            + FT P                              + +   +          +N  + +
Sbjct: 962  LDFTQPVDPNWVREKLELGGFESQWEPVLTEWITAVLQAPLNETGVSLSQLSARNKQVEM 1021

Query: 829  TRLLENPMMTTAMSCDSYSEVSVSGKINCPKKD-----IIISGRIDQISISQQNIFIFEY 883
               L       A   D+           CP  +      ++ G ID +   +   ++ +Y
Sbjct: 1022 EFYLPISEPLIASQLDTLIRQFDPLSAGCPPLEFMQVRGMLKGFIDLVFRHEGRYYLLDY 1081

Query: 884  KTHHHVPQEIEHIPYTHIAQLSIYEKILKDSYP 916
            K+ + + ++     YT  A   +   +    Y 
Sbjct: 1082 KS-NWLGEDSSA--YTQQA---MAAAMQAHRYD 1108


>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Length = 724 Back     alignment and structure
>2is6_A DNA helicase II; hydrolase/DNA complex; HET: DNA ADP; 2.20A {Escherichia coli} PDB: 2is2_A* 2is1_A* 2is4_A* Length = 680 Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Length = 673 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Length = 608 Back     alignment and structure
>1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* Length = 1122 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target952
1w36_B1180 RECB, exodeoxyribonuclease V beta chain; recombination, 100.0
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, helica 100.0
2is6_A680 DNA helicase II; hydrolase/DNA complex; HET: DNA ADP; 2 100.0
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase REP.) 100.0
1w36_C1122 RECC, exodeoxyribonuclease V gamma chain; recombination 99.97
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicase, NM 99.66
2wjy_A800 Regulator of nonsense transcripts 1; alternative splici 99.64
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and beta pr 98.74
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATPase, 97.02
3dmn_A174 Putative DNA helicase; APC89291.2, lactobacillus planta 99.53
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and beta pr 96.56
3h4r_A265 Exodeoxyribonuclease 8; exonuclease, recombination, hyd 99.26
3l0a_A266 Putative exonuclease; RER070207002219, structural genom 99.25
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombination 99.19
2vld_A251 NUCS, UPF0286 protein pyrab01260; endonuclease, hydrola 96.03
3dmn_A174 Putative DNA helicase; APC89291.2, lactobacillus planta 95.49
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
Probab=100.00  E-value=0  Score=764.48  Aligned_cols=756  Identities=16%  Similarity=0.192  Sum_probs=460.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCEEEEECHHCCCHHHHHHHHHHHHHC
Q ss_conf             89999999999999999998699775899999999831584248999998617989998071019999999999984100
Q 537021.9.peg.4  124 LASLTLAKYLNAHYEEAKKKNCVLDFEDLIINTNDLLKKRDVSAWIRYKIDQEINHILIDEVQDTSLIQWEVIRSLTEDF  203 (952)
Q Consensus       124 ~~l~~~~~~~~~~y~~~k~~~~~ldf~Dl~~~a~~lL~~~~~~~~~~~~l~~~~~~ilVDEfQDT~~~Q~~il~~L~~~~  203 (952)
                      ..+.+++..+.+.|.+.|+++|.+||+||++.+.++|.+++ .+.++.+++.+|+|||||||||||++||+||+.|+.+ 
T Consensus       326 ~~l~~~~~~~~~~y~~~k~~~~~ldf~Dl~~~a~~ll~~~~-~~~l~~~l~~r~~~ilVDEfQDTn~~Q~~il~~L~~~-  403 (1180)
T 1w36_B          326 LVITRALAEIRETVAREKRRRGELGFDDMLSRLDSALRSES-GEVLAAAIRTRFPVAMIDEFQDTDPQQYRIFRRIWHH-  403 (1180)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTEECHHHHHHHHHHHHHSTT-HHHHHHHHHHHCSEEEECSGGGCCHHHHHHHHHHHTT-
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCC-HHHHHHHHHHHCCEEEEEHHHCCHHHHHHHHHHHHHC-
T ss_conf             99999999999999999998399980999999999975212-6999999996398999961532399999999999716-


Q ss_pred             CCCCCCCCCCCEEEEEECCHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             24676667686499996665676542488847899999996652134576531200686668878999999999711210
Q 537021.9.peg.4  204 FVGKNTHSSPRTLFAVGDEKQSIYSFHGAEPKRVLREKRINQKRATNAGQKFSIIELPLSFRSTADILTVVDKVFSIPEN  283 (952)
Q Consensus       204 ~~~~~~~~~~~~l~~VGD~kQSIY~FRGAd~~~~~~~~~~f~~~~~~~~~~~~~~~L~~N~RS~~~Ii~~~N~~f~~~~~  283 (952)
                             ..++++|+|||||||||+||||||.+|.++.+.+.          +.+.|++||||+++||+++|.+|.+...
T Consensus       404 -------~~~~~l~~VGDpkQSIY~FRgAd~~~~~~~~~~~~----------~~~~L~~N~RS~~~Il~~~N~lf~~~~~  466 (1180)
T 1w36_B          404 -------QPETALLLIGDPKQAIYAFRGADIFTYMKARSEVH----------AHYTLDTNWRSAPGMVNSVNKLFSQTDD  466 (1180)
T ss_dssp             -------CTTCEEEEEECGGGCCCGGGTCCHHHHHHHHHHCC----------CEEECCEETTSCHHHHHHHHHHHHSSSS
T ss_pred             -------CCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHHH----------HHCCCCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             -------89871899807865330335777799999987643----------4202442457748999999999972522


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC-
Q ss_conf             0123322122212233447888743651134443223343101111100011133336888999999999999835862-
Q 537021.9.peg.4  284 AQGLSEDSTTTIRHRSSRIGQVGTVQLWEQVVSQHDSQCNPQQESWTSYFDSLPQESSASILARRIAYTISNMIGTDTI-  362 (952)
Q Consensus       284 ~~~~~~~~~~~~~~~~~~~~~~g~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~i~~~I~~l~~~~~~-  362 (952)
                      ..........+  ..+.....  .....   .   .....+....+....+...........|+.++..|++++..+.. 
T Consensus       467 ~~~~~~~~~~~--~~~~~~~~--~~~~~---~---~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~ia~~I~~ll~~~~~~  536 (1180)
T 1w36_B          467 AFMFREIPFIP--VKSAGKNQ--ALRFV---F---KGETQPAMKMWLMEGESCGVGDYQSTMAQVCAAQIRDWLQAGQRG  536 (1180)
T ss_dssp             TTSSTTSCCCC--CEECGGGT--TEEEE---E---TTEEECSEEEEECCSSCCCTTHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCCC--HHCCCCCC--CCCCC---C---CCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             11123345310--00025554--43324---6---666665420220466664310377789999999999999820011


Q ss_pred             ----CCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCEE-ECCCCCCCCCCCHHHHHHHHHHHHCCCCCHHH
Q ss_conf             ----2125436878244689861531012248999998741697366-04862112331052268768887481311024
Q 537021.9.peg.4  363 ----FSNGKKRVIQAKDILVLVRKRKDTPLITFLTRFLKNDYKISVV-GNDRFILTDHLAIKDLMALGRFILSQEDDLSF  437 (952)
Q Consensus       363 ----~~~~~~r~~~~~diaVL~r~~~~~~~~~~~l~al~~~~~ip~~-~~~~~~~~~~~~v~~l~a~l~~l~~p~~~~~~  437 (952)
                          ......|+++++|||||||++++...+...|    ..+|||+. ..++.++++++++.+++++|+++.+|.++..+
T Consensus       537 ~~~~~~~~~~r~~~~~DIaILvR~~~~~~~i~~~L----~~~gIp~~~~~~~~~~~~~~ev~~ll~ll~~l~~p~~~~~l  612 (1180)
T 1w36_B          537 EALLMNGDDARPVRASDISVLVRSRQEAAQVRDAL----TLLEIPSVYLSNRDSVFETLEAQEMLWLLQAVMTPERENTL  612 (1180)
T ss_dssp             CEEEEETTEEEECCGGGEEEEESSHHHHHHHHHHH----HTTTCCEEETTCCCBGGGSSHHHHHHHHHHHHTCTTSHHHH
T ss_pred             HHHHCCCCCCCCCCCCCEEEEECCCHHHHHHHHHH----HHCCCCEEEECCCHHHHHCHHHHHHHHHHHHHCCCCCHHHH
T ss_conf             12321454346778142799971537689999889----87499849946731364088999999999861484538999


Q ss_pred             HHHCCCCCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCHHHHH
Q ss_conf             54305877478888999987301268657888764311115899999999999998642199899999998503469999
Q 537021.9.peg.4  438 VCMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFCSPHDFFTLILGAKKGRQQF  517 (952)
Q Consensus       438 ~~~L~spl~g~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  517 (952)
                      ..+|+||++|++..++..+....                  ..+....+.+..++.......+.++++.++........+
T Consensus       613 ~~~l~s~~~g~~~~~l~~l~~~~------------------~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~l  674 (1180)
T 1w36_B          613 RSALATSMMGLNALDIETLNNDE------------------HAWDVVVEEFDGYRQIWRKRGVMPMLRALMSARNIAENL  674 (1180)
T ss_dssp             HHHHHSGGGTCCHHHHHHHHHCH------------------HHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHTTHHHHH
T ss_pred             HHHHHCCCCCCCHHHHHHHHHCH------------------HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             99983734599999999984345------------------778999998999999998667089999999876799999


Q ss_pred             HHCCC-HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCC-------CCCCCCCCCCCCCEEECHHHCCCCCCCEEE
Q ss_conf             81135-2389999999999999852056898999998850100-------132112357885303001221456777799
Q 537021.9.peg.4  518 ISRFG-NEVIDVLDEFLNFTLRNEQNSYSSLQELISELEQYPP-------TIKRAHSANHNEVRIMTVHTAKGLESPVVF  589 (952)
Q Consensus       518 ~~~~~-~~~~~~l~~l~~~a~~~e~~~~~~l~~f~~~l~~~~~-------~~~~~~~~~~d~V~imTiH~SKGLEfpvV~  589 (952)
                      ....+ .....|+..+.+.+..+ .....++..|+.|+.....       .......++.++|+|||||+|||||||+||
T Consensus       675 ~~~~~~~~~~~~l~~l~~~~~~~-~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~V~imTiHkSKGLEfpvV~  753 (1180)
T 1w36_B          675 LATAGGERRLTDILHISELLQEA-GTQLESEHALVRWLSQHILEPDSNASSQQMRLESDKHLVQIVTIHKSKGLEYPLVW  753 (1180)
T ss_dssp             HHSSSHHHHHHHHHHHHHHHHHH-HTTCSCHHHHHHHHHHHHHSCCCCSTTBCCCCTTGGGSEEEEETTTTSSCCEEEEE
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHH-HHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCEEEEEEEEECCCCCCCEEE
T ss_conf             86057689999999999999999-87423278999999999860121124554212203670689741541676678899


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC
Q ss_conf             81588776776544422234455566663123544457874779999999764444678878751146652899983167
Q 537021.9.peg.4  590 LVDTGSQVFSHKHIKKMHIMPSLNDDPGIPIWIPQSKSRNNIVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLIICKHSN  669 (952)
Q Consensus       590 i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ee~RLlYVAlTRAk~~L~l~~~~~  669 (952)
                      ||+++++.++.......    . .......        ............+.+..+|++|||||||||||++|+|++...
T Consensus       754 v~~~~~~~~~~~~~~~~----~-~~~~~~~--------~~~~~~~~~~~~~~e~l~Ee~RLlYVAlTRAk~~L~l~~~~~  820 (1180)
T 1w36_B          754 LPFITNFRVQEQAFYHD----R-HSFEAVL--------DLNAAPESVDLAEAERLAEDLRLLYVALTRSVWHCSLGVAPL  820 (1180)
T ss_dssp             ETTTTCCCCCCSCEEEC----T-TTCCEEE--------ESSCCHHHHHHHHHHHHHHHHHHHHHHHTTEEEEEEEEECCC
T ss_pred             EECCCCCCCCCCCCCCC----C-CCCCCCC--------CCCCCHHHHHHHHHHHHHHHHHHHHEEEECCCCEEEEEEEEC
T ss_conf             93675677766666653----1-0100014--------655465677687899888887876304522335689998401


Q ss_pred             CCCCCCCCC--CCCHHHHHHCCCCCCCCCCCCC---CCCCCCCCCC--------CCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             777666543--2106887310356433222234---5444433222--------11012235544321000122221000
Q 537021.9.peg.4  670 TSNEKKSNQ--RTWYDMVYDSFHNDERVKKIKL---TNSINKDEWI--------AYEWSTHHPENTPLEREETIKQLMDE  736 (952)
Q Consensus       670 ~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~  736 (952)
                      .........  ......+...............   ..........        ................. ........
T Consensus       821 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~  899 (1180)
T 1w36_B          821 VRRRGDKKGDTDVHQSALGRLLQKGEPQDAAGLRTCIEALCDDDIAWQTAQTGDNQPWQVNDVSTAELNAK-TLQRLPGD  899 (1180)
T ss_dssp             CCSCSCCSSCCGGGGSHHHHHHTCSSCCCHHHHHHHHHHSCSTTEEEEECCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCC-CCCCCCCC
T ss_conf             33457766652556766788862677554146899888753776432245543233334565541121221-24556554


Q ss_pred             HHHHHHHCCCCCCC------CCCCCCCCHHHCCHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             01124530334433------233423361110010015554446630155677999999985668996568999999985
Q 537021.9.peg.4  737 QKIPKKLFSPIKND------INEPYILNPSTIDTKGKTNLESLLSDNQTFNRGLIIHKLLQVIFTLPEHKRKNFITSYCT  810 (952)
Q Consensus       737 ~~~~~~~~~~~~~~------~~~~~~l~~s~~~~~~~~~~~~~~~~~~a~~~Gt~vH~~lE~l~~~~~~~~~~~~~~~l~  810 (952)
                      ......+.......      ..................+.......+.|+.+||++|++||++++....+. ..+.+.+.
T Consensus       900 ~~~~~s~s~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~ga~~Gt~~H~ilE~ldf~~~~~~-~~i~~~l~  978 (1180)
T 1w36_B          900 NWRVTSYSGLQQRGHGIAQDLMPRLDVDAAGVASVVEEPTLTPHQFPRGASPGTFLHSLFEDLDFTQPVDP-NWVREKLE  978 (1180)
T ss_dssp             CEEEESSCSSSCSSCTTHHHHCTTSCTTCCCCCCSCCCSSCCGGGSCCSHHHHHHHHHHTTSCCSSSCCCH-HHHHHHHH
T ss_pred             CCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCHHHHHHHHHHHCCCCCCCCH-HHHHHHHH
T ss_conf             32203726664401345554454545553344210027767800147637689999999984899999999-99999998


Q ss_pred             HHCCCCCHHHHHHHHHHHHHHHCCHH------HHHHHCCCCCCCEEEEEEEEC--------------------------C
Q ss_conf             00458998899999999999862965------578717778561137888623--------------------------8
Q 537021.9.peg.4  811 KNAKLWPAKEYKNLLLSITRLLENPM------MTTAMSCDSYSEVSVSGKINC--------------------------P  858 (952)
Q Consensus       811 ~~~~~~~~~~~~~~~~~~~~~l~~~~------~~~~~~~~~~~Ev~~e~~~~~--------------------------~  858 (952)
                      ..  .........+.+.+..++..+.      +..+.......|++|..++..                          .
T Consensus       979 ~~--~~~~~~~~~~~~~l~~~l~~pL~~~~~~l~~~~~~~~~~E~~F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1056 (1180)
T 1w36_B          979 LG--GFESQWEPVLTEWITAVLQAPLNETGVSLSQLSARNKQVEMEFYLPISEPLIASQLDTLIRQFDPLSAGCPPLEFM 1056 (1180)
T ss_dssp             HT--TCCGGGHHHHHHHHHHHHSSCSSSSSCCGGGCCGGGEEEEEEEEEEECSCCCHHHHHHHHHHHCSSTTSCCCCCSC
T ss_pred             HC--CCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHCCHHCCEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             54--9970225999999999980858776766544772021650153222562202888999997336300125432343


Q ss_pred             CCCEEEEEEEEEEEEECCEEEEEECCCCCCCCCC----HHH-----HHHHHHHHHHHHHHHHHHHC----CCCCE-----
Q ss_conf             8858999797789997998999972580138999----899-----99988999999999999967----99827-----
Q 537021.9.peg.4  859 KKDIIISGRIDQISISQQNIFIFEYKTHHHVPQE----IEH-----IPYTHIAQLSIYEKILKDSY----PNKSL-----  920 (952)
Q Consensus       859 ~~~~~i~G~IDri~~~~~~~~IiDyKT~~~~~~~----~~~-----~~~~Y~~QL~~Y~~al~~~~----p~~~V-----  920 (952)
                      ...++|+|+||++|.++|+++|||||||+..++.    .+.     ..++|..||.+|+.||+++.    |+...     
T Consensus      1057 ~~~g~l~G~IDlvf~~dg~~~IvDYKTd~lg~~~~~y~~~~l~~~m~~~~Y~lQ~~lY~~AL~r~L~~r~~~y~~~~h~G 1136 (1180)
T 1w36_B         1057 QVRGMLKGFIDLVFRHEGRYYLLDYKSNWLGEDSSAYTQQAMAAAMQAHRYDLQYQLYTLALHRYLRHRIADYDYEHHFG 1136 (1180)
T ss_dssp             CCEEEEEEEEEEEEBSSSCBCCEEEECCCCCSSGGGSBHHHHHHHHHHTTTHHHHHHHHHHHHHHHHHHSSSCCHHHHCC
T ss_pred             CCEEEEEEEEEEEEEECCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHCC
T ss_conf             54146999999999999999999727899899841029999999988786199999999999999707077987455178


Q ss_pred             EEEEEECCC--------CEEEECCHHHHHHHHHHHH
Q ss_conf             899998559--------8789879899999999765
Q 537021.9.peg.4  921 VCLLIYVSE--------PKVFIIPQNKLNKAFAEIS  948 (952)
Q Consensus       921 ~~~l~y~~~--------~~~~~~~~~~l~~~~~~~~  948 (952)
                      .++.+|+++        |-..+.|+.+|=.+|+++-
T Consensus      1137 g~~YlFlRG~~~~~~~~G~~~~~p~~~~i~~ld~l~ 1172 (1180)
T 1w36_B         1137 GVIYLFLRGVDKEHPQQGIYTTRPNAGLIALMDEMF 1172 (1180)
T ss_dssp             CCEEEESSSCCTTCTTBSCCBCCCCSSHHHHHHHHH
T ss_pred             CEEEEEECCCCCCCCCCCEEEECCCHHHHHHHHHHH
T ss_conf             279999479899999996685059999999999985



>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2is6_A DNA helicase II; hydrolase/DNA complex; HET: DNA ADP; 2.20A {Escherichia coli} PDB: 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; alternative splicing, nonsense mediated decay, zinc-finger, ATP-binding, polymorphism, metal-binding, UPF2; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, hydrolase; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, structural genomics, PSI-2; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, structural genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, hydrolase; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3h4r_A Exodeoxyribonuclease 8; exonuclease, recombination, hydrolase; 2.80A {Escherichia coli k-12} Back     alignment and structure
>3l0a_A Putative exonuclease; RER070207002219, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: PE4; 2.19A {Eubacterium rectale} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2vld_A NUCS, UPF0286 protein pyrab01260; endonuclease, hydrolase; 2.60A {Pyrococcus abyssi} Back     alignment and structure
>3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, structural genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 952
d1w36b2395 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain 1e-33
d1pjra2333 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus s 2e-15
d1uaaa2333 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichi 5e-11
g1qhh.1623 c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bacillus 7e-33
d1w36b1485 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain ( 3e-22
d1w36c2470 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chai 2e-10
d1pjra1318 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus ste 1e-08
d1uaaa1306 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia 5e-06
>d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 395 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V beta chain (RecB), N-terminal domain
species: Escherichia coli [TaxId: 562]
 Score =  139 bits (350), Expect = 1e-33
 Identities = 60/366 (16%), Positives = 130/366 (35%), Gaps = 33/366 (9%)

Query: 324 PQQESWTSYFDSLPQESSASILARRIAYTISNMI-----GTDTIFSNGKKRVIQAKDILV 378
           P  + W    +S       S +A+  A  I + +     G   + +    R ++A DI V
Sbjct: 12  PAMKMWLMEGESCGVGDYQSTMAQVCAAQIRDWLQAGQRGEALLMNGDDARPVRASDISV 71

Query: 379 LVRKRKDTPLITFLTRFLKNDYKISVVGNDRFILTDHLAIKDLMALGRFILSQEDDLSFV 438
           LVR R++   +      L      SV  ++R  + + L  ++++ L + +++ E + +  
Sbjct: 72  LVRSRQEAAQVR---DALTLLEIPSVYLSNRDSVFETLEAQEMLWLLQAVMTPERENTLR 128

Query: 439 CMLKSPLFNFSEDDIFKICTQRHETETVYEYIQKFANCGISKFQHVIKYIHELIHIAQFC 498
             L + +   +  DI       ++       +++F        + + +    +  +    
Sbjct: 129 SALATSMMGLNALDIET---LNNDEHAWDVVVEEFDGY-----RQIWRKRGVMPMLRALM 180

Query: 499 SPHDFFTLILGAKKGRQQFISRFGNEVIDVLDEFLNFTLRNEQNSYSSLQELISELEQYP 558
           S  +    +L    G ++         I  L +     L +E      L + I E +   
Sbjct: 181 SARNIAENLLATAGGERRLTDILH---ISELLQEAGTQLESEHALVRWLSQHILEPDSNA 237

Query: 559 PTIKRAHSANHNEVRIMTVHTAKGLESPVVFLVDTGSQVFSHKHIKKMHIMPSLNDDPGI 618
            + +    ++ + V+I+T+H +KGLE P+V+L    +     +           +D    
Sbjct: 238 SSQQMRLESDKHLVQIVTIHKSKGLEYPLVWLPFITNFRVQEQ--------AFYHDRHSF 289

Query: 619 PIWIPQSKSRNNIVSDLIKHLKKSTQEEYNRLLYVGMTRASDQLII-CKHSNTSNEKKSN 677
              +       N   + +   +     E  RLLYV +TR+     +           K  
Sbjct: 290 EAVLD-----LNAAPESVDLAEAERLAEDLRLLYVALTRSVWHCSLGVAPLVRRRGDKKG 344

Query: 678 QRTWYD 683
               + 
Sbjct: 345 DTDVHQ 350


>d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 333 Back     information, alignment and structure
>d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 485 Back     information, alignment and structure
>d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 470 Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 318 Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target952
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus, Pcr 100.0
d1w36b2395 Exodeoxyribonuclease V beta chain (RecB), N-terminal do 100.0
d1uaaa2333 DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 5 100.0
d1pjra2333 DEXX box DNA helicase {Bacillus stearothermophilus, Pcr 100.0
d1w36c2