254780822

254780822

thioredoxin

GeneID in NCBI database:8209828Locus tag:CLIBASIA_03565
Protein GI in NCBI database:254780822Protein Accession:YP_003065235.1
Gene range:+(433634, 433957)Protein Length:107aa
Gene description:thioredoxin
COG prediction:[O] [C] Thiol-disulfide isomerase and thioredoxins
KEGG prediction:trxA; thioredoxin; K03671 thioredoxin 1
SEED prediction:Thioredoxin
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV
ccEEEEcHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHcccccccEEEEEEccEEEEEEEcccccHHHHHHHHHHcc
cccEEcccccHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHcccccccEEEEEEccEEEEEEEcccccHHHHHHHHHHcc
msalkvdtksfdsevlecsnpvvVDFWaswcrpcvklspIIDDIADELADKVKItkldieesseistryqissiptlilfkdgkvidrmmpgassqsDIIEWILSRV
msalkvdtksfdsevlecSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKitkldieesseistryqissiptlILFKDGKVIDRMmpgassqsdiieWILSRV
MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV
*SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV
MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV
*SALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWIL*RV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV
MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV
MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIEESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target107 thioredoxin [Candidatus Liberibacter asiaticus str. psy
315122045107 thioredoxin [Candidatus Liberibacter solanacearum CLso- 1 3e-39
319898219107 thioredoxin [Bartonella clarridgeiae 73] Length = 107 1 1e-25
49474855107 thioredoxin [Bartonella henselae str. Houston-1] Length 1 3e-25
163867332107 thioredoxin [Bartonella tribocorum CIP 105476] Length = 1 1e-24
158422339106 thioredoxin [Azorhizobium caulinodans ORS 571] Length = 1 2e-24
240849708107 thioredoxin [Bartonella grahamii as4aup] Length = 107 1 3e-24
319404938107 thioredoxin [Bartonella sp. AR 15-3] Length = 107 1 3e-24
17988305107 thioredoxin C-1 [Brucella melitensis bv. 1 str. 16M] Le 1 9e-24
254705106107 thioredoxin [Brucella suis bv. 3 str. 686] Length = 107 1 1e-23
153008152107 thioredoxin [Ochrobactrum anthropi ATCC 49188] Length = 1 1e-23
>gi|315122045|ref|YP_004062534.1| thioredoxin [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 107 Back     alignment and organism information
 Score =  165 bits (417), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/107 (73%), Positives = 93/107 (86%)

Query: 1   MSALKVDTKSFDSEVLECSNPVVVDFWASWCRPCVKLSPIIDDIADELADKVKITKLDIE 60
           M AL  D  +FD EVL+CSNPVVVDFWASWCRPCV LSPIIDD+ADEL+DKVKI K+DIE
Sbjct: 1   MGALATDADNFDLEVLKCSNPVVVDFWASWCRPCVALSPIIDDLADELSDKVKIVKVDIE 60

Query: 61  ESSEISTRYQISSIPTLILFKDGKVIDRMMPGASSQSDIIEWILSRV 107
           ++S ISTRY+I SIPTLILFKDG++ID+MMPG  S++DI +WILS V
Sbjct: 61  KNSSISTRYKIVSIPTLILFKDGQMIDKMMPGGLSKNDISKWILSLV 107


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|319898219|ref|YP_004158312.1| thioredoxin [Bartonella clarridgeiae 73] Length = 107 Back     alignment and organism information
>gi|49474855|ref|YP_032896.1| thioredoxin [Bartonella henselae str. Houston-1] Length = 107 Back     alignment and organism information
>gi|163867332|ref|YP_001608526.1| thioredoxin [Bartonella tribocorum CIP 105476] Length = 107 Back     alignment and organism information
>gi|158422339|ref|YP_001523631.1| thioredoxin [Azorhizobium caulinodans ORS 571] Length = 106 Back     alignment and organism information
>gi|240849708|ref|YP_002971096.1| thioredoxin [Bartonella grahamii as4aup] Length = 107 Back     alignment and organism information
>gi|319404938|emb|CBI78540.1| thioredoxin [Bartonella sp. AR 15-3] Length = 107 Back     alignment and organism information
>gi|17988305|ref|NP_540939.1| thioredoxin C-1 [Brucella melitensis bv. 1 str. 16M] Length = 107 Back     alignment and organism information
>gi|254705106|ref|ZP_05166934.1| thioredoxin [Brucella suis bv. 3 str. 686] Length = 107 Back     alignment and organism information
>gi|153008152|ref|YP_001369367.1| thioredoxin [Ochrobactrum anthropi ATCC 49188] Length = 107 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target107 thioredoxin [Candidatus Liberibacter asiaticus str. psy
TIGR01068101 TIGR01068, thioredoxin, thioredoxin 6e-29
PRK10996139 PRK10996, PRK10996, thioredoxin 2; Provisional 7e-24
cd0294793 cd02947, TRX_family, TRX family; composed of two groups 8e-23
KOG0910150 KOG0910, KOG0910, KOG0910, Thioredoxin-like protein [Po 4e-22
COG3118 304 COG3118, COG3118, Thioredoxin domain-containing protein 6e-21
PRK09381109 PRK09381, trxA, thioredoxin; Provisional 2e-17
cd02961101 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDI 8e-17
cd0295696 cd02956, ybbN, ybbN protein family; ybbN is a hypotheti 1e-14
cd0298497 cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-interact 2e-14
PTZ0005198 PTZ00051, PTZ00051, thioredoxin; Provisional 3e-14
KOG0907106 KOG0907, KOG0907, KOG0907, Thioredoxin [Posttranslation 9e-14
TIGR01126102 TIGR01126, pdi_dom, protein disulfide-isomerase domain 3e-13
cd03004104 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 s 2e-12
cd02998105 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulu 5e-12
KOG0191 383 KOG0191, KOG0191, KOG0191, Thioredoxin/protein disulfid 8e-12
cd03005102 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulu 9e-12
cd03001103 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed 1e-11
KOG0190 493 KOG0190, KOG0190, KOG0190, Protein disulfide isomerase 1e-11
KOG0908 288 KOG0908, KOG0908, KOG0908, Thioredoxin-like protein [Po 2e-11
PTZ00102 477 PTZ00102, PTZ00102, disulphide isomerase; Provisional 8e-11
COG0526127 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxi 2e-10
TIGR01130 462 TIGR01130, ER_PDI_fam, protein disulfide isomerases, eu 2e-10
cd02995104 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal TRX do 5e-10
cd02996108 cd02996, PDI_a_ERp44, PDIa family, endoplasmic reticulu 8e-10
KOG4277 468 KOG4277, KOG4277, KOG4277, Uncharacterized conserved pr 2e-09
PTZ00443224 PTZ00443, PTZ00443, Thioredoxin domain-containing prote 2e-09
KOG0191 383 KOG0191, KOG0191, KOG0191, Thioredoxin/protein disulfid 3e-09
cd03002109 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like subfami 3e-09
cd02962152 cd02962, TMX2, TMX2 family; composed of proteins simila 3e-09
cd02966116 cd02966, TlpA_like_family, TlpA-like family; composed o 7e-09
cd0294997 cd02949, TRX_NTR, TRX domain, novel NADPH thioredoxin r 7e-09
cd03000104 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; compo 1e-08
cd02997104 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; compo 2e-08
KOG0912 375 KOG0912, KOG0912, KOG0912, Thiol-disulfide isomerase an 2e-08
KOG0911 227 KOG0911, KOG0911, KOG0911, Glutaredoxin-related protein 1e-07
KOG0190493 KOG0190, KOG0190, KOG0190, Protein disulfide isomerase 2e-07
cd03011123 cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, supp 2e-07
KOG0914265 KOG0914, KOG0914, KOG0914, Thioredoxin-like protein [Po 3e-07
cd02994101 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; compose 3e-07
TIGR01130462 TIGR01130, ER_PDI_fam, protein disulfide isomerases, eu 4e-07
PRK03147173 PRK03147, PRK03147, thiol-disulfide oxidoreductase; Pro 1e-06
cd02992114 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhydryl o 3e-06
cd02953104 cd02953, DsbDgamma, DsbD gamma family; DsbD gamma is th 5e-06
cd0165969 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily 7e-06
cd02999100 cd02999, PDI_a_ERp44_like, PDIa family, endoplasmic ret 1e-05
PTZ00102477 PTZ00102, PTZ00102, disulphide isomerase; Provisional 2e-05
cd02989113 cd02989, Phd_like_TxnDC9, Phosducin (Phd)-like family, 4e-05
cd02957113 cd02957, Phd_like, Phosducin (Phd)-like family; compose 4e-05
KOG1731 606 KOG1731, KOG1731, KOG1731, FAD-dependent sulfhydryl oxi 5e-05
COG4232569 COG4232, COG4232, Thiol:disulfide interchange protein [ 5e-05
cd02950142 cd02950, TxlA, TRX-like protein A (TxlA) family; TxlA w 1e-04
cd02964132 cd02964, TryX_like_family, Tryparedoxin (TryX)-like fam 2e-04
cd02948102 cd02948, TRX_NDPK, TRX domain, TRX and NDP-kinase (NDPK 3e-04
KOG3414142 KOG3414, KOG3414, KOG3414, Component of the U4/U6 6e-04
cd02963111 cd02963, TRX_DnaJ, TRX domain, DnaJ domain containing p 7e-04
cd03009131 cd03009, TryX_like_TryX_NRX, Tryparedoxin (TryX)-like f 0.002
KOG1672211 KOG1672, KOG1672, KOG1672, ATP binding protein [Posttra 0.002
cd02988192 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Vi 0.003
TIGR00424463 TIGR00424, APS_reduc, 5'-adenylylsulfate reductase, thi 0.003
pfam00085104 pfam00085, Thioredoxin, Thioredoxin 3e-25
cd03010127 cd03010, TlpA_like_DsbE, TlpA-like family, DsbE (also k 2e-05
TIGR00385173 TIGR00385, dsbE, periplasmic protein thiol:disulfide ox 4e-04
>gnl|CDD|162187 TIGR01068, thioredoxin, thioredoxin Back     alignment and domain information
>gnl|CDD|182889 PRK10996, PRK10996, thioredoxin 2; Provisional Back     alignment and domain information
>gnl|CDD|48496 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>gnl|CDD|36128 KOG0910, KOG0910, KOG0910, Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|32932 COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|181812 PRK09381, trxA, thioredoxin; Provisional Back     alignment and domain information
>gnl|CDD|48510 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>gnl|CDD|48505 cd02956, ybbN, ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>gnl|CDD|48533 cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>gnl|CDD|173347 PTZ00051, PTZ00051, thioredoxin; Provisional Back     alignment and domain information
>gnl|CDD|36125 KOG0907, KOG0907, KOG0907, Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162212 TIGR01126, pdi_dom, protein disulfide-isomerase domain Back     alignment and domain information
>gnl|CDD|48553 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>gnl|CDD|48547 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>gnl|CDD|35412 KOG0191, KOG0191, KOG0191, Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48554 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>gnl|CDD|48550 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>gnl|CDD|35411 KOG0190, KOG0190, KOG0190, Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|36126 KOG0908, KOG0908, KOG0908, Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185446 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|30872 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162215 TIGR01130, ER_PDI_fam, protein disulfide isomerases, eukaryotic Back     alignment and domain information
>gnl|CDD|48544 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>gnl|CDD|48545 cd02996, PDI_a_ERp44, PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>gnl|CDD|39478 KOG4277, KOG4277, KOG4277, Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|185622 PTZ00443, PTZ00443, Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|35412 KOG0191, KOG0191, KOG0191, Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48551 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>gnl|CDD|48511 cd02962, TMX2, TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>gnl|CDD|48515 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>gnl|CDD|48498 cd02949, TRX_NTR, TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>gnl|CDD|48549 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>gnl|CDD|48546 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>gnl|CDD|36130 KOG0912, KOG0912, KOG0912, Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones, Energy production and conversion] Back     alignment and domain information
>gnl|CDD|36129 KOG0911, KOG0911, KOG0911, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35411 KOG0190, KOG0190, KOG0190, Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48560 cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>gnl|CDD|36132 KOG0914, KOG0914, KOG0914, Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48543 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>gnl|CDD|162215 TIGR01130, ER_PDI_fam, protein disulfide isomerases, eukaryotic Back     alignment and domain information
>gnl|CDD|179545 PRK03147, PRK03147, thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|48541 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>gnl|CDD|48502 cd02953, DsbDgamma, DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>gnl|CDD|48494 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>gnl|CDD|48548 cd02999, PDI_a_ERp44_like, PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>gnl|CDD|185446 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|48538 cd02989, Phd_like_TxnDC9, Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>gnl|CDD|48506 cd02957, Phd_like, Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>gnl|CDD|36942 KOG1731, KOG1731, KOG1731, FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|33957 COG4232, COG4232, Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|48499 cd02950, TxlA, TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>gnl|CDD|48513 cd02964, TryX_like_family, Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>gnl|CDD|48497 cd02948, TRX_NDPK, TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>gnl|CDD|38624 KOG3414, KOG3414, KOG3414, Component of the U4/U6 Back     alignment and domain information
>gnl|CDD|48512 cd02963, TRX_DnaJ, TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>gnl|CDD|48558 cd03009, TryX_like_TryX_NRX, Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>gnl|CDD|36885 KOG1672, KOG1672, KOG1672, ATP binding protein [Posttranslational modification, protein turnover, chaperones, Energy production and conversion] Back     alignment and domain information
>gnl|CDD|48537 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>gnl|CDD|161873 TIGR00424, APS_reduc, 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>gnl|CDD|143866 pfam00085, Thioredoxin, Thioredoxin Back     alignment and domain information
>gnl|CDD|48559 cd03010, TlpA_like_DsbE, TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>gnl|CDD|129481 TIGR00385, dsbE, periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 107 thioredoxin [Candidatus Liberibacter asiaticus str. psy
TIGR01068101 thioredoxin thioredoxin; InterPro: IPR005746 Thioredoxi 100.0
TIGR01126107 pdi_dom protein disulfide-isomerase domain; InterPro: I 99.98
TIGR01130 522 ER_PDI_fam protein disulfide isomerases; InterPro: IPR0 99.97
PRK09381109 trxA thioredoxin; Provisional 99.97
PRK10996139 thioredoxin 2; Provisional 99.97
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryo 99.96
PTZ00102 479 disulphide isomerase; Provisional 99.95
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 99.95
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; 99.95
TIGR01130522 ER_PDI_fam protein disulfide isomerases; InterPro: IPR0 99.95
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reductase ( 99.95
pfam00085104 Thioredoxin Thioredoxin. Thioredoxins are small enzymes 99.95
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; compos 99.95
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protein fam 99.94
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 99.94
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; 99.94
COG3118 304 Thioredoxin domain-containing protein [Posttranslationa 99.94
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of prote 99.94
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 99.94
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical protei 99.94
KOG0910150 consensus 99.94
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed of pro 99.94
PTZ00102479 disulphide isomerase; Provisional 99.94
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') 99.93
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (AP 99.92
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QS 99.92
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of euk 99.92
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulum pro 99.92
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was origina 99.91
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin 99.91
KOG0190 493 consensus 99.9
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) family, 99.9
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induced st 99.89
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion p 99.89
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxi 99.88
PTZ0005198 thioredoxin; Provisional 99.88
cd0294793 TRX_family TRX family; composed of two groups: Group I, 99.85
KOG0908 288 consensus 99.85
KOG0190493 consensus 99.85
KOG0907106 consensus 99.84
cd02957113 Phd_like Phosducin (Phd)-like family; composed of Phd a 99.82
cd02962152 TMX2 TMX2 family; composed of proteins similar to human 99.78
pfam01216 350 Calsequestrin Calsequestrin. 99.78
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EF 99.77
KOG0912 375 consensus 99.77
KOG4277 468 consensus 99.75
KOG0191 383 consensus 99.74
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-termin 99.74
KOG0191 383 consensus 99.68
PHA0212575 thioredoxin-like protein 99.67
KOG1731 606 consensus 99.66
PRK03147176 thiol-disulfide oxidoreductase; Provisional 99.58
PRK00293577 dipZ thiol:disulfide interchange protein precursor; Pro 99.57
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, 99.56
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known as Cc 99.48
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for 99.48
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, Try 99.46
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfami 99.42
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; compo 99.41
cd02967114 mauD Methylamine utilization (mau) D family; mauD prote 99.34
COG4232569 Thiol:disulfide interchange protein [Posttranslational 99.3
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily 99.23
TIGR00385175 dsbE periplasmic protein thiol:disulfide oxidoreductase 99.22
cd02966116 TlpA_like_family TlpA-like family; composed of TlpA, Re 99.21
KOG0913 248 consensus 99.19
TIGR0041182 redox_disulf_1 redox-active disulfide protein 1; InterP 99.14
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-de 99.08
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetic 99.08
KOG0914265 consensus 99.06
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; 98.92
TIGR00424469 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-ind 98.89
KOG1672211 consensus 98.89
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibi 98.89
pfam00578124 AhpC-TSA AhpC/TSA family. This family contains proteins 98.88
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfam 98.87
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [Posttr 98.87
COG2143182 Thioredoxin-related protein [Posttranslational modifica 98.83
pfam08534142 Redoxin Redoxin. This family of redoxins includes perox 98.8
KOG0911 227 consensus 98.79
cd02958114 UAS UAS family; UAS is a domain of unknown function. Mo 98.78
KOG2501157 consensus 98.64
PRK13703247 conjugal pilus assembly protein TraF; Provisional 98.63
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; compos 98.58
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monome 98.58
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin co 98.51
pfam02114265 Phosducin Phosducin. 98.51
cd02955124 SSP411 TRX domain, SSP411 protein family; members of th 98.43
TIGR02740306 TraF-like TraF-like protein; InterPro: IPR014111 This e 98.41
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like sub 98.38
PRK10877232 thiol:disulfide interchange protein DsbC; Provisional 98.35
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 small 98.34
pfam06110119 DUF953 Eukaryotic protein of unknown function (DUF953). 98.26
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V- 98.22
KOG2603 331 consensus 98.21
pfam03190163 DUF255 Protein of unknown function, DUF255. 98.19
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide oxid 98.18
TIGR02187 237 GlrX_arch Glutaredoxin-like domain protein; InterPro: I 98.18
PRK09437156 bcp thioredoxin-dependent thiol peroxidase; Reviewed 98.15
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of the 98.13
TIGR02187237 GlrX_arch Glutaredoxin-like domain protein; InterPro: I 98.09
TIGR02738176 TrbB type-F conjugative transfer system pilin assembly 98.07
TIGR0219679 GlrX_YruB Glutaredoxin-like protein, YruB-family; Inter 98.07
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a large, 98.05
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like 97.98
pfam11009104 DUF2847 Protein of unknown function (DUF2847). Some mem 97.96
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protei 97.96
KOG3425128 consensus 97.96
cd02965111 HyaE HyaE family; HyaE is also called HupG and HoxO. Th 97.93
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-like fa 97.92
pfam07912126 ERp29_N ERp29, N-terminal domain. ERp29 is a ubiquitous 97.9
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') famil 97.89
cd02960130 AGR Anterior Gradient (AGR) family; members of this fam 97.89
KOG3414142 consensus 97.88
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide red 97.85
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP 97.83
pfam02966133 DIM1 Mitosis protein DIM1. 97.81
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like doma 97.72
PRK1120087 grxA glutaredoxin 1; Provisional 97.71
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monome 97.67
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) family, 97.67
PRK11657253 dsbG disulfide isomerase/thiol-disulfide oxidase; Provi 97.65
smart00594122 UAS UAS domain. 97.65
PRK13728181 conjugal transfer protein TrbB; Provisional 97.61
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 97.59
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox i 97.57
KOG3171273 consensus 97.35
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 97.31
TIGR02661189 MauD methylamine dehydrogenase accessory protein MauD; 97.3
KOG3170240 consensus 97.28
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys P 97.18
TIGR0220078 GlrX_actino Glutaredoxin-like protein; InterPro: IPR011 97.05
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 97.04
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacter 97.01
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human 96.99
COG1331 667 Highly conserved protein containing a thioredoxin domai 96.78
COG069580 GrxC Glutaredoxin and related proteins [Posttranslation 96.75
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of GRX, 96.74
PRK1063883 glutaredoxin 3; Provisional 96.74
pfam0576876 DUF836 Glutaredoxin-like domain (DUF836). These protein 96.7
TIGR0218085 GRX_euk Glutaredoxin; InterPro: IPR011899 Glutaredoxins 96.69
pfam0046260 Glutaredoxin Glutaredoxin. 96.47
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, puta 96.41
PHA02278106 thioredoxin-like protein 96.36
KOG2640 319 consensus 96.35
KOG1752104 consensus 96.33
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, 96.24
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of protei 96.24
TIGR02739270 TraF type-F conjugative transfer system pilin assembly 96.18
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid s 96.13
pfam07449107 HyaE Hydrogenase-1 expression protein HyaE. This family 96.01
pfam01216350 Calsequestrin Calsequestrin. 95.96
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacti 95.89
TIGR0041278 redox_disulf_2 redox-active disulfide protein 2; InterP 95.25
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TR 95.15
PRK10824115 hypothetical protein; Provisional 94.99
PRK1032981 glutaredoxin-like protein; Provisional 94.47
TIGR0218386 GRXA Glutaredoxin, GrxA family; InterPro: IPR011902 Glu 93.76
PTZ00056180 glutathione peroxidase; Provisional 93.22
COG3019149 Predicted metal-binding protein [General function predi 93.16
cd0297494 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (Ahp 93.15
TIGR0218182 GRX_bact glutaredoxin 3; InterPro: IPR011900 Glutaredox 92.66
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, prot 92.55
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 91.81
pfam0768982 KaiB KaiB domain. The cyanobacterial clock proteins Kai 91.6
PRK09301103 circadian clock protein KaiB; Provisional 91.13
PTZ00256183 glutathione peroxidase; Provisional 90.48
cd03068107 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox i 90.27
PRK10954207 periplasmic protein disulfide isomerase I; Provisional 97.98
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetic 96.93
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA-like 96.26
PTZ00062219 glutaredoxin; Provisional 94.35
cd0297872 KaiB_like KaiB-like family; composed of the circadian c 90.5
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c Oxida 90.45
COG1651244 DsbG Protein-disulfide isomerase [Posttranslational mod 96.59
cd03024201 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-l 92.08
COG2761225 FrnE Predicted dithiol-disulfide isomerase involved in 90.77
cd03025193 DsbA_FrnE_like DsbA family, FrnE-like subfamily; compos 90.1
>TIGR01068 thioredoxin thioredoxin; InterPro: IPR005746 Thioredoxins , , , are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain; InterPro: IPR005788 This is a domain of eukaryotic protein disulphide isomerases, generally found in two copies Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases; InterPro: IPR005792 This family represents eukaryotic protein disulphide isomerases retained in the endoplasmic reticulum (ER) and other closely related forms Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases; InterPro: IPR005792 This family represents eukaryotic protein disulphide isomerases retained in the endoplasmic reticulum (ER) and other closely related forms Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>pfam00085 Thioredoxin Thioredoxin Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>KOG0910 consensus Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>KOG0190 consensus Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>KOG0908 consensus Back     alignment and domain information
>KOG0190 consensus Back     alignment and domain information
>KOG0907 consensus Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>pfam01216 Calsequestrin Calsequestrin Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>KOG0912 consensus Back     alignment and domain information
>KOG4277 consensus Back     alignment and domain information
>KOG0191 consensus Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>KOG0191 consensus Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>KOG1731 consensus Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily; InterPro: IPR004799 Periplasmic protein thiol:disulphide oxidoreductase is involved in the biogenesis of c-type cytochromes as well as in disulphide bond formation in some periplasmic proteins Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>KOG0913 consensus Back     alignment and domain information
>TIGR00411 redox_disulf_1 redox-active disulfide protein 1; InterPro: IPR004502 This group of proteins includes thioredoxins, glutaredoxins, protein-disulphide isomerases, and others, some of which have several such domains Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>KOG0914 consensus Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent; InterPro: IPR004508 This enzyme, involved in the assimilation of inorganic sulphate, is closely related to the thioredoxin-dependent PAPS reductase of Bacteria (CysH) and Saccharomyces cerevisiae Back     alignment and domain information
>KOG1672 consensus Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>pfam00578 AhpC-TSA AhpC/TSA family Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam08534 Redoxin Redoxin Back     alignment and domain information
>KOG0911 consensus Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>KOG2501 consensus Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>pfam02114 Phosducin Phosducin Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein; InterPro: IPR014111 This entry contains TraF-like proteins that are related to the F-type conjugation system pilus assembly proteins TraF (IPR014110 from INTERPRO)and TrbB (IPR014109 from INTERPRO) both of which exhibit a thioredoxin fold Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>PRK10877 thiol:disulfide interchange protein DsbC; Provisional Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>pfam06110 DUF953 Eukaryotic protein of unknown function (DUF953) Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>KOG2603 consensus Back     alignment and domain information
>pfam03190 DUF255 Protein of unknown function, DUF255 Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein; InterPro: IPR011903 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein; InterPro: IPR011903 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB; InterPro: IPR014109 This entry includes thiol-disulphide isomerase (TrbB), a protein that is involved in conjugative transfer of plasmid DNA, specifically in the F-type system Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family; InterPro: IPR011911 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>pfam11009 DUF2847 Protein of unknown function (DUF2847) Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>KOG3425 consensus Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>pfam07912 ERp29_N ERp29, N-terminal domain Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>KOG3414 consensus Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>pfam02966 DIM1 Mitosis protein DIM1 Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>KOG3171 consensus Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD; InterPro: IPR013478 MauD appears critical to proper formation of the small subunit of methylamine dehydrogenase, which has both an unusual tryptophan tryptophylquinone cofactor and multiple disulphide bonds Back     alignment and domain information
>KOG3170 consensus Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein; InterPro: IPR011915 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>pfam05768 DUF836 Glutaredoxin-like domain (DUF836) Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin; InterPro: IPR011899 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>pfam00462 Glutaredoxin Glutaredoxin Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative; InterPro: IPR005985 Class II bacteriocins are small are ribosomally-synthesized, non-lantibiotic peptide antibiotics produced by many bacteria Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>KOG2640 consensus Back     alignment and domain information
>KOG1752 consensus Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF; InterPro: IPR014110 This entry includes TraF; a protein that is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically in the F-type system Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>pfam07449 HyaE Hydrogenase-1 expression protein HyaE Back     alignment and domain information
>pfam01216 Calsequestrin Calsequestrin Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>TIGR00412 redox_disulf_2 redox-active disulfide protein 2; InterPro: IPR005243 This small protein is found in three archaeal species so far (Methanococcus jannaschii, Archaeoglobus fulgidus, and Methanobacterium thermoautotrophicum (strain Marburg / DSM 2133)) as well as in Anabaena Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PRK10824 hypothetical protein; Provisional Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family; InterPro: IPR011902 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>COG3019 Predicted metal-binding protein [General function prediction only] Back     alignment and domain information
>cd02974 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>TIGR02181 GRX_bact glutaredoxin 3; InterPro: IPR011900 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam07689 KaiB KaiB domain Back     alignment and domain information
>PRK09301 circadian clock protein KaiB; Provisional Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd02978 KaiB_like KaiB-like family; composed of the circadian clock proteins, KaiB and the N-terminal KaiB-like sensory domain of SasA Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif Back     alignment and domain information
>COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03025 DsbA_FrnE_like DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target107 thioredoxin [Candidatus Liberibacter asiaticus str. psy
2o8v_B128 Paps Reductase In A Covalent Complex With Thioredox 3e-23
2h76_A108 Crystal Structure Of Thioredoxin Mutant D10e In Hex 3e-23
1keb_A108 Crystal Structure Of Double Mutant M37l,P40s E.Coli 4e-23
2h74_A108 Crystal Structure Of Thioredoxin Mutant D2e In Hexa 4e-23
2trx_A108 Crystal Structure Of Thioredoxin From Escherichia C 4e-23
2h6y_A108 Crystal Structure Of Thioredoxin Mutant E48d In Hex 4e-23
2h71_A108 Crystal Structure Of Thioredoxin Mutant D47e In Hex 4e-23
2h73_A108 Crystal Structure Of Thioredoxin Mutant D43e In Hex 4e-23
2h75_A108 Crystal Structure Of Thioredoxin Mutant D13e In Hex 5e-23
1xob_A108 Thioredoxin (Reduced Dithio Form), Nmr, 20 Structur 6e-23
3dyr_A111 Crystal Structure Of E. Coli Thioredoxin Mutant I76 6e-23
2fch_A108 Crystal Structure Of Thioredoxin Mutant G74s Length 6e-23
1zzy_A108 Crystal Structure Of Thioredoxin Mutant L7v Length 7e-23
2h70_A108 Crystal Structure Of Thioredoxin Mutant D9e In Hexa 7e-23
2h6z_A108 Crystal Structure Of Thioredoxin Mutant E44d In Hex 7e-23
1f6m_C108 Crystal Structure Of A Complex Between Thioredoxin 8e-23
2fd3_A108 Crystal Structure Of Thioredoxin Mutant P34h Length 9e-23
2eiq_A108 Design Of Disulfide-Linked Thioredoxin Dimers And M 1e-22
2tir_A108 Crystal Structure Analysis Of A Mutant Escherichia 2e-22
2h72_A108 Crystal Structure Of Thioredoxin Mutant E85d In Hex 2e-22