peg_476

peg_476

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(502455, 503180)Protein Length:241aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:virulence factor MviN-like protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED5 TM-Helix
HMMTOP5 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM5 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
VLMKLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDGVIHNSFIPMFSQRREQNGSENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGFPYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPRLTCNVKLFLS
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEcc
VLMKLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAargdgvihnsfipmfsqrreqngsenaWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYvmapgfpyqsdeyfLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGvelrfqyprltcnvKLFLS
VLMKLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDGVIHNSFIPMFSQRREQNGSENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGFPYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYprltcnvklfls
VLMKLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDGVIHNSFIPMFSQRREQNGSENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGFPYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPRLTCNVKLFLS
***K**RNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDGVIHNSFIPMFSQRRE****ENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGFPYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPRLTCNVKLFLS
VLMKLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDGVIHNSFIPMFSQ*********AWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGFPYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPRLTCNVKLFLS
VLMKLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDGVIHNSFIPMFSQRREQNGSENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGFPYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPRLTCNVKLFLS
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VLMKLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDGVIHNSFIPMFSQRREQNGSENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGFPYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPRLTCNVKLFLS
VLMKLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDGVIHNSFIPMFSQRREQNGSENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGFPYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPRLTCNVKLFLS
VLMKLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDGVIHNSFIPMFSQRREQNGSENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGFPYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPRLTCNVKLFLS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target241
254780793 518 integral membrane protein MviN [Candidatus Liberib 2e-77
>gi|254780793|ref|YP_003065206.1| integral membrane protein MviN [Candidatus Liberibacter asiaticus str. psy62] Length = 518 Back     alignment
 Score =  280 bits (716), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 147/238 (61%), Positives = 188/238 (78%), Gaps = 4/238 (1%)

Query: 3   MKLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDG 62
           MK++RNF T+ AS   +R LGF+R +L+AA  GVGK+TD FY   Y+ FIF RLAA  +G
Sbjct: 1   MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAA--EG 58

Query: 63  VIHNSFIPMFSQRREQNGSENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGF 122
           + HNSFIP+FSQ +E NGSE+A RLSSE+FS+L+  L+V+ +V+EL+LPLL+R+++APGF
Sbjct: 59  IFHNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGF 118

Query: 123 PYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTY 182
             QSD+YFLT+QLSRV+ PSI FISLASLVTG+LFA GRYFIA +  +VI++ PIF LTY
Sbjct: 119 ADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTY 178

Query: 183 ALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPRLTCNVKLFL 240
           AL + S+    E  YLL WGVFL++ V+FWI+Y  AK  GV+LRFQYPRLT NVK FL
Sbjct: 179 ALWHPSSPQ--ETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFL 234

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target241
254780793 518 integral membrane protein MviN [Candidatus Liberibacter 1 1e-73
315122015 519 integral membrane protein MviN [Candidatus Liberibacter 1 2e-56
209547641 528 integral membrane protein MviN [Rhizobium leguminosarum 1 7e-36
260462739 532 integral membrane protein MviN [Mesorhizobium opportuni 1 6e-35
7387908 533 RecName: Full=Virulence factor mviN homolog Length = 53 1 9e-35
222147342 532 integral membrane protein MviN [Agrobacterium vitis S4] 1 9e-35
13474439 526 virulence factor MviN-like protein [Mesorhizobium loti 1 9e-35
319779936 535 integral membrane protein MviN [Mesorhizobium ciceri bi 1 1e-34
241202798 526 integral membrane protein MviN [Rhizobium leguminosarum 1 3e-34
86356043 526 virulence factor transmembrane protein [Rhizobium etli 1 3e-34
>gi|254780793|ref|YP_003065206.1| integral membrane protein MviN [Candidatus Liberibacter asiaticus str. psy62] Length = 518 Back     alignment and organism information
 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 147/238 (61%), Positives = 188/238 (78%), Gaps = 4/238 (1%)

Query: 3   MKLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDG 62
           MK++RNF T+ AS   +R LGF+R +L+AA  GVGK+TD FY   Y+ FIF RLAA  +G
Sbjct: 1   MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAA--EG 58

Query: 63  VIHNSFIPMFSQRREQNGSENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGF 122
           + HNSFIP+FSQ +E NGSE+A RLSSE+FS+L+  L+V+ +V+EL+LPLL+R+++APGF
Sbjct: 59  IFHNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGF 118

Query: 123 PYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTY 182
             QSD+YFLT+QLSRV+ PSI FISLASLVTG+LFA GRYFIA +  +VI++ PIF LTY
Sbjct: 119 ADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTY 178

Query: 183 ALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPRLTCNVKLFL 240
           AL + S+    E  YLL WGVFL++ V+FWI+Y  AK  GV+LRFQYPRLT NVK FL
Sbjct: 179 ALWHPSSPQ--ETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFL 234


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122015|ref|YP_004062504.1| integral membrane protein MviN [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 519 Back     alignment and organism information
>gi|209547641|ref|YP_002279558.1| integral membrane protein MviN [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 528 Back     alignment and organism information
>gi|260462739|ref|ZP_05810944.1| integral membrane protein MviN [Mesorhizobium opportunistum WSM2075] Length = 532 Back     alignment and organism information
>gi|7387908|sp|O05467|MVIN_RHITR RecName: Full=Virulence factor mviN homolog Length = 533 Back     alignment and organism information
>gi|222147342|ref|YP_002548299.1| integral membrane protein MviN [Agrobacterium vitis S4] Length = 532 Back     alignment and organism information
>gi|13474439|ref|NP_106007.1| virulence factor MviN-like protein [Mesorhizobium loti MAFF303099] Length = 526 Back     alignment and organism information
>gi|319779936|ref|YP_004139412.1| integral membrane protein MviN [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 535 Back     alignment and organism information
>gi|241202798|ref|YP_002973894.1| integral membrane protein MviN [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 526 Back     alignment and organism information
>gi|86356043|ref|YP_467935.1| virulence factor transmembrane protein [Rhizobium etli CFN 42] Length = 526 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target241
TIGR01695 502 TIGR01695, mviN, integral membrane protein MviN 2e-19
pfam03023 452 pfam03023, MVIN, MviN-like protein 1e-13
COG0728 518 COG0728, MviN, Uncharacterized membrane protein, putati 2e-22
>gnl|CDD|162493 TIGR01695, mviN, integral membrane protein MviN Back     alignment and domain information
>gnl|CDD|111867 pfam03023, MVIN, MviN-like protein Back     alignment and domain information
>gnl|CDD|31072 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 241
TIGR01695 538 mviN integral membrane protein MviN; InterPro: IPR00426 100.0
COG0728 518 MviN Uncharacterized membrane protein, putative virulen 100.0
pfam03023452 MVIN MviN-like protein. Deletion of the mviN virulence 99.75
TIGR02900 493 spore_V_B stage V sporulation protein B; InterPro: IPR0 99.72
PRK10459492 colanic acid exporter; Provisional 99.63
PRK01766 452 multidrug efflux protein; Reviewed 99.62
PRK09575 456 vmrA multidrug efflux pump VmrA; Reviewed 99.6
COG0728518 MviN Uncharacterized membrane protein, putative virulen 99.59
PRK10189 481 hypothetical protein; Provisional 99.57
TIGR01695538 mviN integral membrane protein MviN; InterPro: IPR00426 99.57
COG0534 455 NorM Na+-driven multidrug efflux pump [Defense mechanis 99.56
PRK10367 439 DNA-damage-inducible SOS response protein; Provisional 99.53
TIGR00797 412 matE MATE efflux family protein; InterPro: IPR002528 Ch 99.51
PRK09575456 vmrA multidrug efflux pump VmrA; Reviewed 99.51
PRK01766452 multidrug efflux protein; Reviewed 99.46
PRK10459 492 colanic acid exporter; Provisional 99.45
PRK10189481 hypothetical protein; Provisional 99.39
PRK00187 462 multidrug efflux protein NorA; Provisional 99.38
COG2244480 RfbX Membrane protein involved in the export of O-antig 99.37
PRK00187462 multidrug efflux protein NorA; Provisional 99.35
pfam01943272 Polysacc_synt Polysaccharide biosynthesis protein. Memb 99.34
COG0534455 NorM Na+-driven multidrug efflux pump [Defense mechanis 99.28
TIGR02900493 spore_V_B stage V sporulation protein B; InterPro: IPR0 99.22
PRK10367439 DNA-damage-inducible SOS response protein; Provisional 98.88
KOG1347 473 consensus 94.6
pfam03023 452 MVIN MviN-like protein. Deletion of the mviN virulence 100.0
COG2244 480 RfbX Membrane protein involved in the export of O-antig 99.39
pfam01554161 MatE MatE. The MatE domain 99.31
TIGR00797412 matE MATE efflux family protein; InterPro: IPR002528 Ch 98.34
pfam04506533 Rft-1 Rft protein. 90.26
>TIGR01695 mviN integral membrane protein MviN; InterPro: IPR004268 The sequencing of a number of pathogenic bacterial genomes has led to novel virulence proteins being discovered that are yet to be biochemically characterised Back     alignment and domain information
>COG0728 MviN Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>pfam03023 MVIN MviN-like protein Back     alignment and domain information
>TIGR02900 spore_V_B stage V sporulation protein B; InterPro: IPR014249 This entry represents SpoVB, which is the stage V sporulation protein B of the bacterial endospore formation program in Bacillus subtilis and various other Firmcutes Back     alignment and domain information
>PRK10459 colanic acid exporter; Provisional Back     alignment and domain information
>PRK01766 multidrug efflux protein; Reviewed Back     alignment and domain information
>PRK09575 vmrA multidrug efflux pump VmrA; Reviewed Back     alignment and domain information
>COG0728 MviN Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>PRK10189 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01695 mviN integral membrane protein MviN; InterPro: IPR004268 The sequencing of a number of pathogenic bacterial genomes has led to novel virulence proteins being discovered that are yet to be biochemically characterised Back     alignment and domain information
>COG0534 NorM Na+-driven multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK10367 DNA-damage-inducible SOS response protein; Provisional Back     alignment and domain information
>TIGR00797 matE MATE efflux family protein; InterPro: IPR002528 Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters Back     alignment and domain information
>PRK09575 vmrA multidrug efflux pump VmrA; Reviewed Back     alignment and domain information
>PRK01766 multidrug efflux protein; Reviewed Back     alignment and domain information
>PRK10459 colanic acid exporter; Provisional Back     alignment and domain information
>PRK10189 hypothetical protein; Provisional Back     alignment and domain information
>PRK00187 multidrug efflux protein NorA; Provisional Back     alignment and domain information
>COG2244 RfbX Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>PRK00187 multidrug efflux protein NorA; Provisional Back     alignment and domain information
>pfam01943 Polysacc_synt Polysaccharide biosynthesis protein Back     alignment and domain information
>COG0534 NorM Na+-driven multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>TIGR02900 spore_V_B stage V sporulation protein B; InterPro: IPR014249 This entry represents SpoVB, which is the stage V sporulation protein B of the bacterial endospore formation program in Bacillus subtilis and various other Firmcutes Back     alignment and domain information
>PRK10367 DNA-damage-inducible SOS response protein; Provisional Back     alignment and domain information
>KOG1347 consensus Back     alignment and domain information
>pfam03023 MVIN MviN-like protein Back     alignment and domain information
>COG2244 RfbX Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>pfam01554 MatE MatE Back     alignment and domain information
>TIGR00797 matE MATE efflux family protein; InterPro: IPR002528 Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters Back     alignment and domain information
>pfam04506 Rft-1 Rft protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target241
3mkt_A460 Multi antimicrobial extrusion protein (Na(+)/drug antip 99.39
3mkt_A 460 Multi antimicrobial extrusion protein (Na(+)/drug antip 99.19
>3mkt_A Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux...; multidrug transporter, cation-bound, transport protein; 3.65A {Vibrio cholerae} PDB: 3mku_A Back     alignment and structure
Probab=99.39  E-value=7.7e-11  Score=76.29  Aligned_cols=195  Identities=10%  Similarity=-0.037  Sum_probs=139.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH
Q ss_conf             99999999999999999999995765679999999963499999998655667775589999998510079999999999
Q 537021.9.peg.4   12 LVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDGVIHNSFIPMFSQRREQNGSENAWRLSSEV   91 (241)
Q Consensus        12 i~~~tl~SrilGf~Re~~~A~~fGa~~~~DAf~~A~~iP~~l~~l~~~~~Gal~~~fIP~~~~~~~~~~~~~a~~~~~~~   91 (241)
                      ........-..++.-...++..+|+ .+.++|.++.++-.+.....    .+++++..|...+...+++.+++++.....
T Consensus       246 p~~~~~~~~~~~~~~~~~~~~~~g~-~~~aa~~i~~~i~~~~~~~~----~~l~~a~~~~vg~~~G~~~~~~~~~~~~~~  320 (460)
T 3mkt_A          246 PVAAALFFEVTLFAVVALLVAPLGS-TVVAAHQVALNFSSLVFMFP----MSIGAAVSIRVGHKLGEQDTKGAAIAANVG  320 (460)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTCTTSS-HHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHSSCCCTTTTHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCC-CHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             2788999999999999999872687-12259899999999999999----999999999999987277689999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999998714332102476321024688899999999999998999999999999999868998677788
Q 537021.9.peg.4   92 FSVLLPILMVMIMVIELVLPLLVRYVMAPGFPYQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMV  171 (241)
Q Consensus        92 ~~~~~~~~~~i~~l~~ifap~~v~~l~apGf~~~~~~~~la~~l~ri~~p~i~f~~l~~i~~~~L~a~~~F~~~a~~pi~  171 (241)
                      +.+......++..+.+++.+++.. ++    .+|++..+++..++++..+..++.+++.+..+++|+-+|-..+....++
T Consensus       321 ~~~~~~~~~~~~~l~~~~~~~i~~-~f----~~d~~~~~~~~~~l~~~~l~~~~~~~~~~~~~~l~g~g~~~~~~~~~~~  395 (460)
T 3mkt_A          321 LMTGLATACITALLTVLFREQIAL-LY----TENQVVVALAMQLLLFAAIYQCMDAVQVVAAGSLRGYKDMTAIFHRTFI  395 (460)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHT-CS----SCCSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGSTHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH-HC----CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH
T ss_conf             984489999999999999999986-26----8989999999999999999999999999999999986748999999999


Q ss_pred             HHH-HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999-999999999960465573168999999999999999999999
Q 537021.9.peg.4  172 IHI-LPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYL  216 (241)
Q Consensus       172 ~Ni-~~I~~~~~~~~~~~~~~~~~~i~~la~g~~lg~~~q~l~~~~  216 (241)
                      ... +.+...++............++.+.-||..++..++.++...
T Consensus       396 ~~~~i~ip~~~~l~~~~~~~~~~~G~~Giw~~~~~~~~~~~~~~~~  441 (460)
T 3mkt_A          396 SYWVLGLPTGYILGMTNWLTEQPLGAKGFWLGFIIGLSAAALMLGQ  441 (460)
T ss_dssp             HHHHHHHHHHHHHHHHHTSSCCSSHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999852352446999999999999999999999



>3mkt_A Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux...; multidrug transporter, cation-bound, transport protein; 3.65A {Vibrio cholerae} PDB: 3mku_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00