peg_477

peg_477

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(503330, 504037)Protein Length:235aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:virulence factor MviN homolog
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM6 TM-Helix
TOPPRED6 TM-Helix
HMMTOP6 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG
cccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccEEcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccc
maallpklSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYErgaftaqdTILVSSYLSIYSTEIVGFLLSRVLLSEfyarndvktpaKFYILSIVMGFVIAIGLfpfiggygiATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKpclfnqlsaetafspfknLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG
maallpklssaiqlenKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG
MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG
MAALLPKLS*************LRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKT***
MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG
MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKT***
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG
MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG
MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target235
254780793518 integral membrane protein MviN [Candidatus Liberib 9e-77
>gi|254780793|ref|YP_003065206.1| integral membrane protein MviN [Candidatus Liberibacter asiaticus str. psy62] Length = 518 Back     alignment
 Score =  277 bits (709), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 145/232 (62%), Positives = 181/232 (78%), Gaps = 2/232 (0%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           M  +LP LS +++ +NKQ+S EL+N+AIE + FFGIP    L ML KEI+QTLYERGAF+
Sbjct: 287 MIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFS 346

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           +Q+TILVSS+LSIYS  I+  +LS+ L + FYA+ND+K P KF I+SI +   IAIG FP
Sbjct: 347 SQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFP 406

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFK 180
           FIGGYGIA AEVS  WVNTICLA+ LLKR+QI+LPF+TIYRILS+ IS+GLMG FI+ F+
Sbjct: 407 FIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFR 466

Query: 181 PCLFNQL-SAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
           P  FNQ  SA T F PFKNL I+LSGA+LVYL SI L LGK FL+ L+  ++
Sbjct: 467 P-YFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIR 517

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target235
254780793518 integral membrane protein MviN [Candidatus Liberibacter 1 7e-73
315122015519 integral membrane protein MviN [Candidatus Liberibacter 1 3e-54
116250173526 transmembrane mviN virulence factor homologue [Rhizobiu 1 4e-30
241202798526 integral membrane protein MviN [Rhizobium leguminosarum 1 4e-30
209547641528 integral membrane protein MviN [Rhizobium leguminosarum 1 7e-30
327188579526 virulence factor transmembrane protein [Rhizobium etli 1 1e-28
218516517294 virulence factor transmembrane protein [Rhizobium etli 1 4e-28
190890056526 virulence factor transmembrane protein [Rhizobium etli 1 4e-28
163842414529 integral membrane protein MviN [Brucella suis ATCC 2344 1 6e-28
23501055529 virulence factor MviN [Brucella suis 1330] Length = 529 1 6e-28
>gi|254780793|ref|YP_003065206.1| integral membrane protein MviN [Candidatus Liberibacter asiaticus str. psy62] Length = 518 Back     alignment and organism information
 Score =  277 bits (709), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 145/232 (62%), Positives = 181/232 (78%), Gaps = 2/232 (0%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           M  +LP LS +++ +NKQ+S EL+N+AIE + FFGIP    L ML KEI+QTLYERGAF+
Sbjct: 287 MIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFS 346

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           +Q+TILVSS+LSIYS  I+  +LS+ L + FYA+ND+K P KF I+SI +   IAIG FP
Sbjct: 347 SQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFP 406

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFK 180
           FIGGYGIA AEVS  WVNTICLA+ LLKR+QI+LPF+TIYRILS+ IS+GLMG FI+ F+
Sbjct: 407 FIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFR 466

Query: 181 PCLFNQL-SAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
           P  FNQ  SA T F PFKNL I+LSGA+LVYL SI L LGK FL+ L+  ++
Sbjct: 467 P-YFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIR 517


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122015|ref|YP_004062504.1| integral membrane protein MviN [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 519 Back     alignment and organism information
>gi|116250173|ref|YP_766011.1| transmembrane mviN virulence factor homologue [Rhizobium leguminosarum bv. viciae 3841] Length = 526 Back     alignment and organism information
>gi|241202798|ref|YP_002973894.1| integral membrane protein MviN [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 526 Back     alignment and organism information
>gi|209547641|ref|YP_002279558.1| integral membrane protein MviN [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 528 Back     alignment and organism information
>gi|327188579|gb|EGE55789.1| virulence factor transmembrane protein [Rhizobium etli CNPAF512] Length = 526 Back     alignment and organism information
>gi|218516517|ref|ZP_03513357.1| virulence factor transmembrane protein [Rhizobium etli 8C-3] Length = 294 Back     alignment and organism information
>gi|190890056|ref|YP_001976598.1| virulence factor transmembrane protein [Rhizobium etli CIAT 652] Length = 526 Back     alignment and organism information
>gi|163842414|ref|YP_001626818.1| integral membrane protein MviN [Brucella suis ATCC 23445] Length = 529 Back     alignment and organism information
>gi|23501055|ref|NP_697182.1| virulence factor MviN [Brucella suis 1330] Length = 529 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target235
pfam03023452 pfam03023, MVIN, MviN-like protein 3e-21
TIGR01695502 TIGR01695, mviN, integral membrane protein MviN 1e-19
COG0534 455 COG0534, NorM, Na+-driven multidrug efflux pump [Defens 8e-04
COG0728518 COG0728, MviN, Uncharacterized membrane protein, putati 2e-21
>gnl|CDD|111867 pfam03023, MVIN, MviN-like protein Back     alignment and domain information
>gnl|CDD|162493 TIGR01695, mviN, integral membrane protein MviN Back     alignment and domain information
>gnl|CDD|30880 COG0534, NorM, Na+-driven multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|31072 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 235
pfam03023452 MVIN MviN-like protein. Deletion of the mviN virulence 100.0
PRK10189 481 hypothetical protein; Provisional 99.92
PRK01766 452 multidrug efflux protein; Reviewed 99.91
TIGR02900493 spore_V_B stage V sporulation protein B; InterPro: IPR0 99.91
pfam03023 452 MVIN MviN-like protein. Deletion of the mviN virulence 99.67
COG0728 518 MviN Uncharacterized membrane protein, putative virulen 99.14
TIGR01695 538 mviN integral membrane protein MviN; InterPro: IPR00426 99.0
KOG1347 473 consensus 98.9
PRK10459 492 colanic acid exporter; Provisional 97.23
pfam01943272 Polysacc_synt Polysaccharide biosynthesis protein. Memb 94.99
TIGR01695538 mviN integral membrane protein MviN; InterPro: IPR00426 100.0
COG0728518 MviN Uncharacterized membrane protein, putative virulen 100.0
PRK10459492 colanic acid exporter; Provisional 99.95
TIGR00797 412 matE MATE efflux family protein; InterPro: IPR002528 Ch 99.94
COG0534 455 NorM Na+-driven multidrug efflux pump [Defense mechanis 99.92
PRK09575 456 vmrA multidrug efflux pump VmrA; Reviewed 99.92
PRK00187 462 multidrug efflux protein NorA; Provisional 99.88
PRK10367 439 DNA-damage-inducible SOS response protein; Provisional 99.9
COG2244480 RfbX Membrane protein involved in the export of O-antig 99.86
PRK09575456 vmrA multidrug efflux pump VmrA; Reviewed 99.6
PRK01766452 multidrug efflux protein; Reviewed 99.5
PRK10189481 hypothetical protein; Provisional 99.42
COG0534455 NorM Na+-driven multidrug efflux pump [Defense mechanis 99.37
PRK00187462 multidrug efflux protein NorA; Provisional 99.34
TIGR02900 493 spore_V_B stage V sporulation protein B; InterPro: IPR0 99.12
PRK10367439 DNA-damage-inducible SOS response protein; Provisional 98.95
KOG2864530 consensus 98.83
pfam04506533 Rft-1 Rft protein. 98.63
pfam01554161 MatE MatE. The MatE domain 99.55
TIGR00797412 matE MATE efflux family protein; InterPro: IPR002528 Ch 98.47
>pfam03023 MVIN MviN-like protein Back     alignment and domain information
>PRK10189 hypothetical protein; Provisional Back     alignment and domain information
>PRK01766 multidrug efflux protein; Reviewed Back     alignment and domain information
>TIGR02900 spore_V_B stage V sporulation protein B; InterPro: IPR014249 This entry represents SpoVB, which is the stage V sporulation protein B of the bacterial endospore formation program in Bacillus subtilis and various other Firmcutes Back     alignment and domain information
>pfam03023 MVIN MviN-like protein Back     alignment and domain information
>COG0728 MviN Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>TIGR01695 mviN integral membrane protein MviN; InterPro: IPR004268 The sequencing of a number of pathogenic bacterial genomes has led to novel virulence proteins being discovered that are yet to be biochemically characterised Back     alignment and domain information
>KOG1347 consensus Back     alignment and domain information
>PRK10459 colanic acid exporter; Provisional Back     alignment and domain information
>pfam01943 Polysacc_synt Polysaccharide biosynthesis protein Back     alignment and domain information
>TIGR01695 mviN integral membrane protein MviN; InterPro: IPR004268 The sequencing of a number of pathogenic bacterial genomes has led to novel virulence proteins being discovered that are yet to be biochemically characterised Back     alignment and domain information
>COG0728 MviN Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>PRK10459 colanic acid exporter; Provisional Back     alignment and domain information
>TIGR00797 matE MATE efflux family protein; InterPro: IPR002528 Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters Back     alignment and domain information
>COG0534 NorM Na+-driven multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK09575 vmrA multidrug efflux pump VmrA; Reviewed Back     alignment and domain information
>PRK00187 multidrug efflux protein NorA; Provisional Back     alignment and domain information
>PRK10367 DNA-damage-inducible SOS response protein; Provisional Back     alignment and domain information
>COG2244 RfbX Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>PRK09575 vmrA multidrug efflux pump VmrA; Reviewed Back     alignment and domain information
>PRK01766 multidrug efflux protein; Reviewed Back     alignment and domain information
>PRK10189 hypothetical protein; Provisional Back     alignment and domain information
>COG0534 NorM Na+-driven multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK00187 multidrug efflux protein NorA; Provisional Back     alignment and domain information
>TIGR02900 spore_V_B stage V sporulation protein B; InterPro: IPR014249 This entry represents SpoVB, which is the stage V sporulation protein B of the bacterial endospore formation program in Bacillus subtilis and various other Firmcutes Back     alignment and domain information
>PRK10367 DNA-damage-inducible SOS response protein; Provisional Back     alignment and domain information
>KOG2864 consensus Back     alignment and domain information
>pfam04506 Rft-1 Rft protein Back     alignment and domain information
>pfam01554 MatE MatE Back     alignment and domain information
>TIGR00797 matE MATE efflux family protein; InterPro: IPR002528 Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target235
3mkt_A 460 Multi antimicrobial extrusion protein (Na(+)/drug antip 99.56
3mkt_A460 Multi antimicrobial extrusion protein (Na(+)/drug antip 99.44
>3mkt_A Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux...; multidrug transporter, cation-bound, transport protein; 3.65A {Vibrio cholerae} PDB: 3mku_A Back     alignment and structure
Probab=99.56  E-value=7.1e-14  Score=85.89  Aligned_cols=169  Identities=13%  Similarity=0.161  Sum_probs=128.1

Q ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             77998899629789999999999999999999999999998899999997078988899877777899999999999655
Q 537021.9.peg.4    5 LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLS   84 (235)
Q Consensus         5 lP~lS~~~~~~~~~~~~~~l~~~l~~~~~i~iP~~~gl~~l~~piv~~lf~~G~f~~~~~~~~~~~L~~~~~~l~~~~l~   84 (235)
                      -+..||+..+||+++.++..++++.....+++|..+.+. ..+++...+    ..+++........+.+..+++++..+.
T Consensus        72 ~~lvaq~~G~~~~~~~~~~~~~~l~~~~~~~i~~~~~~~-~~~~i~~~~----~~~~~~~~~a~~Y~~~~~~~~~~~~~~  146 (460)
T 3mkt_A           72 VPVVAQLNGAGRQHKIPFEVHQGLILALLVSVPIIAVLF-QTQFIIRFM----DVEEAMATKTVGYMHAVIFAVPAYLLF  146 (460)
T ss_dssp             GGGCTTTTSSSSTTTHHHHHHHHHHHHHHHHHHHHHHHH-HHHTTCSSC----SSTTHHHHHHHHHHTTGGGHHHHHHHH
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHH----CCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999973999899999999999999999998889986-699999996----253999999876403010013126788


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HCCCCHHHHHHHHHHHHHHHHHHHHHHHHC--------
Q ss_conf             344577877665433457889999888643245531------012102313102799999999999999711--------
Q 537021.9.peg.4   85 RVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP------FIGGYGIATAEVSWVWVNTICLAVALLKRR--------  150 (235)
Q Consensus        85 ~il~~~~ya~~~~~~p~~~~~i~~iini~l~~~li~------~~g~~G~a~at~is~~v~~~il~~~l~k~~--------  150 (235)
                      ..+...+++.+|+|.|++.++.+.++|+++|+.++.      ..|..|.++|++++.+........+..++.        
T Consensus       147 ~~~~~~l~~~g~~~~~~~~~i~~~i~ni~l~~~li~g~~~~~~~~~~G~a~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~  226 (460)
T 3mkt_A          147 QALRSFTDGMSLTKPAMVIGFIGLLLNIPLNWIFVYGKFGAPELGGVGCGVATAIVYWIMLLLLLFYIVTSKRLAHVKVF  226 (460)
T ss_dssp             HHHTTTTCTTSCCTTTHHHHHHHHHHHHHHHHHHHSCCTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCCCS
T ss_pred             HHHHHHHCCCCCCCHHHHHHHHCCCCEEECCCCEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             99876520454553157643211332122144101146556651078999998888999854467775530011111210


Q ss_pred             --CCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             --3666688999999999999999999999
Q 537021.9.peg.4  151 --QIDLPFQTIYRILSIFISSGLMGMFIVF  178 (235)
Q Consensus       151 --~~~~~~~~~~~~~k~~~as~im~~~~~~  178 (235)
                        ..+...+..++..+..+.+.+.......
T Consensus       227 ~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~  256 (460)
T 3mkt_A          227 ETFHKPQPKELIRLFRLGFPVAAALFFEVT  256 (460)
T ss_dssp             CCCCSSTTSSTTTSHHHHHHHHHHHHHHHH
T ss_pred             HHCCCHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             210221456654213357827889999999



>3mkt_A Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux...; multidrug transporter, cation-bound, transport protein; 3.65A {Vibrio cholerae} PDB: 3mku_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00