peg_60

peg_60

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(57051, 57185)Protein Length:44aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40----
LYQAVSVIDERIIPVNIKKLLIVSLLSSTAIISGCDSHSGDGVH
ccHHHHHHHccEEEccHHHHHHHHHHHcccEEEccccccccccc
cccEEEEEEccEcEccHHHHHHHHHHcccEEEEccccccccccc
LYQAVSvideriipvNIKKLLIVSLLSSTAiisgcdshsgdgvh
lyqavsvideriipvnIKKLLIVSLLSSTaiisgcdshsgdgvh
LYQAVSVIDERIIPVNikkllivsllssTAIISGCDSHSGDGVH
***AVSVIDERIIPVNIKKLLIVSLLSSTAIISGC*********
LYQAVSVIDERIIPVNIKKLLIVSLLSSTAIISGC*********
LYQAVSVIDERIIPVNIKKLLIVSLLSSTAIISGCD********
oooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxx
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
oooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LYQAVSVIDERIIPVNIKKLLIVSLLSSTAIISGCDSHSGDGVH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target44
25478100585 hypothetical protein CLIBASIA_04530 [Candidatus Li 0.023
>gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Back     alignment
 Score = 28.5 bits (62), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 18/21 (85%)

Query: 15 VNIKKLLIVSLLSSTAIISGC 35
          ++IK L++ SL+SST I+SGC
Sbjct: 1  MDIKGLIVASLISSTVIMSGC 21

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00