254780174

254780174

putative oxidoreductase protein

GeneID in NCBI database:8209152Locus tag:CLIBASIA_00285
Protein GI in NCBI database:254780174Protein Accession:YP_003064587.1
Gene range:+(56147, 56383)Protein Length:78aa
Gene description:putative oxidoreductase protein
COG prediction:none
KEGG prediction:putative oxidoreductase protein
SEED prediction:PUTATIVE OXIDOREDUCTASE PROTEIN
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------
MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYDRLEPWTH
cccccccccccccccccccccccccccEEEEEccHHHHHHHHHHccccEEEEcccccccccccHHHHccccccccccc
cccccccccccccccccccccccccccEEEEcccHHHHHHHHHHccccEEEEccccccccccHHHHHccccccccccc
mlefekitppyiepllgytsskdTLQQVKLFFPSLEAAEKYasdhgiqycvipsckesqkelsyqrnfsydrlepwth
mlefekitppyiepllgytsSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKELsyqrnfsydrlepwth
MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYDRLEPWTH
MLEFEK*TPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCK******SYQRNFSYDRLEPW**
MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYDRLEPWTH
*L*FEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYDR******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYDRLEPWTH
MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYDRLEPWTH
MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYDRLEPWTH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target78 putative oxidoreductase protein [Candidatus Liberibacte
315122677103 putative oxidoreductase protein [Candidatus Liberibacte 1 3e-28
15965469101 putative oxidoreductase protein [Sinorhizobium meliloti 1 4e-15
254469257101 ETC complex I subunit conserved region [Pseudovibrio sp 1 7e-15
150396660101 ETC complex I subunit region [Sinorhizobium medicae WSM 1 9e-15
222148688101 hypothetical protein Avi_2288 [Agrobacterium vitis S4] 1 3e-14
222085832101 NADH-ubiquinone oxidoreductase protein [Agrobacterium r 1 6e-14
15889112101 hypothetical protein Atu1810 [Agrobacterium tumefaciens 1 7e-14
163930881106 Chain A, Nmr Solution Structure Of Protein Atu1810 From 1 8e-14
325293214101 NADH-ubiquinone oxidoreductase protein [Agrobacterium s 1 8e-14
209549151101 ETC complex subunit I [Rhizobium leguminosarum bv. trif 1 1e-13
>gi|315122677|ref|YP_004063166.1| putative oxidoreductase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 103 Back     alignment and organism information
 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 67/78 (85%)

Query: 1   MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQK 60
           +LEFE+   PYIEPLLGYTSSKDTLQQVKLFF SLE AEKYA DH IQY VIP  KESQK
Sbjct: 26  VLEFERQIAPYIEPLLGYTSSKDTLQQVKLFFLSLEEAEKYAKDHEIQYHVIPLHKESQK 85

Query: 61  ELSYQRNFSYDRLEPWTH 78
           ++SYQ NFSY+RLEPWTH
Sbjct: 86  KISYQNNFSYNRLEPWTH 103


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15965469|ref|NP_385822.1| putative oxidoreductase protein [Sinorhizobium meliloti 1021] Length = 101 Back     alignment and organism information
>gi|254469257|ref|ZP_05082662.1| ETC complex I subunit conserved region [Pseudovibrio sp. JE062] Length = 101 Back     alignment and organism information
>gi|150396660|ref|YP_001327127.1| ETC complex I subunit region [Sinorhizobium medicae WSM419] Length = 101 Back     alignment and organism information
>gi|222148688|ref|YP_002549645.1| hypothetical protein Avi_2288 [Agrobacterium vitis S4] Length = 101 Back     alignment and organism information
>gi|222085832|ref|YP_002544363.1| NADH-ubiquinone oxidoreductase protein [Agrobacterium radiobacter K84] Length = 101 Back     alignment and organism information
>gi|15889112|ref|NP_354793.1| hypothetical protein Atu1810 [Agrobacterium tumefaciens str. C58] Length = 101 Back     alignment and organism information
>gi|163930881|pdb|2JYA|A Chain A, Nmr Solution Structure Of Protein Atu1810 From Agrobacterium Tumefaciens. Northeast Structural Genomics Consortium Target Atr23, Ontario Centre For Structural Proteomics Target Atc1776 Length = 106 Back     alignment and organism information
>gi|325293214|ref|YP_004279078.1| NADH-ubiquinone oxidoreductase protein [Agrobacterium sp. H13-3] Length = 101 Back     alignment and organism information
>gi|209549151|ref|YP_002281068.1| ETC complex subunit I [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 101 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target78 putative oxidoreductase protein [Candidatus Liberibacte
KOG3389178 KOG3389, KOG3389, KOG3389, NADH:ubiquinone oxidoreducta 0.001
pfam04800101 pfam04800, ETC_C1_NDUFA4, ETC complex I subunit conserv 2e-09
>gnl|CDD|38599 KOG3389, KOG3389, KOG3389, NADH:ubiquinone oxidoreductase, NDUFS4/18 kDa subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|113566 pfam04800, ETC_C1_NDUFA4, ETC complex I subunit conserved region Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 78 putative oxidoreductase protein [Candidatus Liberibacte
pfam04800101 ETC_C1_NDUFA4 ETC complex I subunit conserved region. F 99.97
KOG3389178 consensus 99.9
>pfam04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region Back     alignment and domain information
>KOG3389 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target78 putative oxidoreductase protein [Candidatus Liberibacte
2jya_A106 Nmr Solution Structure Of Protein Atu1810 From Agro 1e-27
>gi|163930881|pdb|2JYA|A Chain A, Nmr Solution Structure Of Protein Atu1810 From Agrobacterium Tumefaciens. Northeast Structural Genomics Consortium Target Atr23, Ontario Centre For Structural Proteomics Target Atc1776 Length = 106 Back     alignment and structure
 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 52/78 (66%)

Query: 1   MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQK 60
           +LEF+   P  I+P++GYTSS D  QQVKL F + E AE YA   GI+Y VI   + ++K
Sbjct: 27  VLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRK 86

Query: 61  ELSYQRNFSYDRLEPWTH 78
            +SY  NF ++R +PWTH
Sbjct: 87  VVSYTDNFRFNRTQPWTH 104


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target78 putative oxidoreductase protein [Candidatus Liberibacte
2jya_A106 AGR_C_3324P, uncharacterized protein ATU1810; protein w 6e-23
>2jya_A AGR_C_3324P, uncharacterized protein ATU1810; protein with unknown function ATU1810, ontario centre for structural proteomics; NMR {Agrobacterium tumefaciens str} Length = 106 Back     alignment and structure
 Score =  100 bits (252), Expect = 6e-23
 Identities = 38/77 (49%), Positives = 51/77 (66%)

Query: 2   LEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKE 61
           LEF+   P  I+P++GYTSS D  QQVKL F + E AE YA   GI+Y VI   + ++K 
Sbjct: 28  LEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKV 87

Query: 62  LSYQRNFSYDRLEPWTH 78
           +SY  NF ++R +PWTH
Sbjct: 88  VSYTDNFRFNRTQPWTH 104


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target78 putative oxidoreductase protein [Candidatus Liberibacte
2jya_A106 AGR_C_3324P, uncharacterized protein ATU1810; protein w 100.0
>2jya_A AGR_C_3324P, uncharacterized protein ATU1810; protein with unknown function ATU1810, ontario centre for structural proteomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
Probab=100.00  E-value=2.3e-36  Score=244.13  Aligned_cols=78  Identities=49%  Similarity=0.831  Sum_probs=77.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             900036689820777363027776520499819989999999986984899567767755655655204678888889
Q gi|254780174|r    1 MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYDRLEPWTH   78 (78)
Q Consensus         1 vLEfe~~~~~~~dpLMGWtss~Dt~~qv~L~F~tkE~Ai~yA~~~g~~y~V~~p~~r~~~~ksYadNF~~~R~~~WtH   78 (78)
                      +|||++..++++||||||+||+||++||+|+|+|+|+||+||+++||+|+|++|+.|++++|||||||++||++||||
T Consensus        27 ~Lef~~~~~~~~dpLMGWtsS~Dt~~qv~L~F~skE~Ai~yA~k~g~~y~V~ep~~r~~~~ksYadNF~~~R~~~wtH  104 (106)
T 2jya_A           27 VLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKVVSYTDNFRFNRTQPWTH  104 (106)
T ss_dssp             EEEEEEECCSCCCTTTCSCSCCCSEEEEEEEESSHHHHHHHHHHHTCEEEECCCTTC---------------------
T ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHCCCCCCCCCCC
T ss_conf             998716777434787442266774686388758999999999986983999756766676341799777788877889




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 78 putative oxidoreductase protein [Candidatus Liberi
2jya_A_106 (A:) AGR_C_3324P, uncharacterized protein ATU1810; 2e-24
>2jya_A (A:) AGR_C_3324P, uncharacterized protein ATU1810; protein with unknown function ATU1810, ontario centre for structural proteomics; NMR {Agrobacterium tumefaciens str}Length = 106 Back     alignment and structure
 Score =  105 bits (265), Expect = 2e-24
 Identities = 38/78 (48%), Positives = 52/78 (66%)

Query: 1   MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQK 60
           +LEF+   P  I+P++GYTSS D  QQVKL F + E AE YA   GI+Y VI   + ++K
Sbjct: 27  VLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRK 86

Query: 61  ELSYQRNFSYDRLEPWTH 78
            +SY  NF ++R +PWTH
Sbjct: 87  VVSYTDNFRFNRTQPWTH 104


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target78 putative oxidoreductase protein [Candidatus Liberibacte
2jya_A_106 AGR_C_3324P, uncharacterized protein ATU1810; prot 100.0
>2jya_A (A:) AGR_C_3324P, uncharacterized protein ATU1810; protein with unknown function ATU1810, ontario centre for structural proteomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
Probab=100.00  E-value=1.4e-36  Score=246.31  Aligned_cols=78  Identities=49%  Similarity=0.831  Sum_probs=77.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             900036689820777363027776520499819989999999986984899567767755655655204678888889
Q gi|254780174|r    1 MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYDRLEPWTH   78 (78)
Q Consensus         1 vLEfe~~~~~~~dpLMGWtss~Dt~~qv~L~F~tkE~Ai~yA~~~g~~y~V~~p~~r~~~~ksYadNF~~~R~~~WtH   78 (78)
                      +|||++..++++|||||||||+||++||+|.|+|+|+||+||+++||+|+|++|+.+++++|||||||+|||++||||
T Consensus        27 ~lefe~~~~r~~~PLMGWtsS~D~~~qv~l~F~skE~AIayaek~G~~y~V~~p~~r~~~~ksYadNF~~~r~~~wth  104 (106)
T 2jya_A           27 VLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKVVSYTDNFRFNRTQPWTH  104 (106)
T ss_dssp             EEEEEEECCSCCCTTTCSCSCCCSEEEEEEEESSHHHHHHHHHHHTCEEEECCCTTC---------------------
T ss_pred             EEEEECCCCCCCCCCCCEECCCCCCCCEEEEECCHHHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHCCCCCCCCCCC
T ss_conf             998406788756787352066875575188858999999999987965999815866666451689677888977889