peg_612

peg_612

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(639601, 639762)Protein Length:53aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50---
LDDFHLSDLIHEESSPGFYFHYQKTIMSNSIFHKSKMDLKKENNFFETRTTEY
cccHHHHHHHHccccccEEEEEEEEHHccHHHHHHHccHHHHccccHHHcccc
cccccHHHHHcccccccEEEEEEEEEEcccHcccccccccHcccccccccccc
lddfhlsdliheesspgfyfHYQKTIMSNSIFHKSKMDLKkennffetrttey
LDDFHLSDLIHEESSPGFYFHYQKTIMSNSIFHKSkmdlkkennffetrttey
LDDFHLSDLIHEESSPGFYFHYQKTIMSNSIFHKSKMDLKKENNFFETRTTEY
**DFHLSDLIHEESSPGFYFHYQKTIMSNSIFHKSKMDLKKENNFF*******
LDDFHLSDLIHEESSPGFYFHYQKTIMSNSIFHKSKMDLKKENNFFETRTTEY
**DFHLSDLIHEESSPGFYFHYQKTIMSNSIFHKSKMDLK**N**FET*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LDDFHLSDLIHEESSPGFYFHYQKTIMSNSIFHKSKMDLKKENNFFETRTTEY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target53
254780964352 ribonucleotide-diphosphate reductase subunit beta 8e-04
254780845352 ribonucleotide-diphosphate reductase subunit beta 8e-04
254781006125 ribonucleotide-diphosphate reductase subunit beta 0.001
254780136125 ribonucleotide-diphosphate reductase subunit beta 0.001
>gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Back     alignment
 Score = 33.1 bits (74), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%)

Query: 37  MDLKKENNFFETRTTEY 53
           +DLKKE NFFETR TEY
Sbjct: 327 IDLKKEKNFFETRVTEY 343

>gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Back     alignment
 Score = 33.1 bits (74), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%)

Query: 37  MDLKKENNFFETRTTEY 53
           +DLKKE NFFETR TEY
Sbjct: 327 IDLKKEKNFFETRVTEY 343

>gi|254781006|ref|YP_003065419.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Back     alignment
 Score = 32.7 bits (73), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%)

Query: 37  MDLKKENNFFETRTTEY 53
           +DLKKE NFFETR TEY
Sbjct: 100 IDLKKEKNFFETRVTEY 116

>gi|254780136|ref|YP_003064549.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Back     alignment
 Score = 32.7 bits (73), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%)

Query: 37  MDLKKENNFFETRTTEY 53
           +DLKKE NFFETR TEY
Sbjct: 100 IDLKKEKNFFETRVTEY 116

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target53
PRK07209369 PRK07209, PRK07209, ribonucleotide-diphosphate reductas 4e-05
>gnl|CDD|180886 PRK07209, PRK07209, ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 53
PRK07209391 ribonucleotide-diphosphate reductase subunit beta; Vali 94.74
>PRK07209 ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00