254780630

254780630

ribonuclease PH

GeneID in NCBI database:8209630Locus tag:CLIBASIA_02585
Protein GI in NCBI database:254780630Protein Accession:YP_003065043.1
Gene range:+(640500, 641228)Protein Length:242aa
Gene description:ribonuclease PH
COG prediction:[J] RNase PH
KEGG prediction:rph; ribonuclease PH (EC:2.7.7.56); K00989 ribonuclease PH [EC:2.7.7.56]
SEED prediction:Ribonuclease PH (EC 2.7.7.56)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA processing;
Heat shock dnaK gene cluster extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MRLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWITAEYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGYPIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDVISNEV
ccccccccccEEEEEEEEccccccccEEEEEEcccEEEEEEEEccccccccccccEEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHcccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEccEEEEcccHHHHHHccEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccccccccEEEEEcccccccEEEEEEEccEEEEEEEEEEccccHHHccccccEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHEcHHHHcccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEcccEEEEEEEEEccEEEEcccHHHHHcccEEEEEEEEccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mrlsgrqenqMREISLTRRvskyaegsclvkfgdthllttatleekvpmwirntkhgwitaeygmlprstgnrvkreavsgrqggrsQEIQRMIGRALRSVVDlsalgsrqiiidcdviqadggtrtAAITGAWVALHDCLQHMedcsnkfqlSQVLKGHVAAISCGmlcgypivdldygedstidvdanfvmtdsghivevqgsaeratfsQDHFFAMLNLAKDRIADLIKLQKDVISNEV
mrlsgrqenqmreisltrrvskyaegsclvkfgdthllttatleekvpmwIRNTKHgwitaeygmlprstgnrvkreavsgrqggrsqeiQRMIGRALRSVVDLSALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGYPIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQkdvisnev
MRLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWITAEYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGYPIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDVISNEV
****GRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWITAEYGMLPRS******************QEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGYPIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDVIS***
************EISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWITAEYGMLPRSTGN****************EIQRMIGRALRSVVDLSALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGYPIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDVISNEV
**********MREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWITAEYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGYPIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDVISN**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWITAEYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGYPIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDVISNEV
MRLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWITAEYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGYPIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDVISNEV
MRLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWITAEYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGYPIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDVISNEV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target242 ribonuclease PH [Candidatus Liberibacter asiaticus str.
254780784 699 polynucleotide phosphorylase/polyadenylase [Candid 3e-07
>gi|254780784|ref|YP_003065197.1| polynucleotide phosphorylase/polyadenylase [Candidatus Liberibacter asiaticus str. psy62] Length = 699 Back     alignment
 Score = 47.0 bits (110), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 8/144 (5%)

Query: 1   MRLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATL----EEKVPMWIRNTKH 56
           +R+ GR    +R+IS    + +   GS L   GDT  +   TL    +E+    +  T+ 
Sbjct: 312 VRMDGRDSETVRDISAQVGLLQRTHGSSLFIRGDTQAIVVVTLGTREDEQYVDSLSGTQR 371

Query: 57  GWITAEYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDC 116
                 Y  LP +TG   +  A S R+ G      R+  RA+  V+  +A     + I  
Sbjct: 372 NDFMMHYNFLPCATGEVSRMGAPSRREIGHG----RLARRAIHPVLPQTAQFPYTLRIVS 427

Query: 117 DVIQADGGTRTAAITGAWVALHDC 140
           ++ ++DG +  A + G+ +AL D 
Sbjct: 428 EITESDGSSSMATVCGSSLALMDA 451

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target242 ribonuclease PH [Candidatus Liberibacter asiaticus str.
315121831250 ribonuclease PH [Candidatus Liberibacter solanacearum C 1 1e-118
159184261238 ribonuclease PH [Agrobacterium tumefaciens str. C58] Le 1 1e-89
222084657238 ribonuclease PH [Agrobacterium radiobacter K84] Length 1 2e-89
15964129239 ribonuclease PH [Sinorhizobium meliloti 1021] Length = 1 6e-89
222147322239 ribonuclease PH [Agrobacterium vitis S4] Length = 239 1 8e-89
325291761238 ribonuclease PH [Agrobacterium sp. H13-3] Length = 238 1 9e-89
209547618239 ribonuclease PH [Rhizobium leguminosarum bv. trifolii W 1 4e-88
227820597239 ribonuclease PH [Sinorhizobium fredii NGR234] Length = 1 1e-87
150395238239 ribonuclease PH [Sinorhizobium medicae WSM419] Length = 1 1e-87
116250149239 ribonuclease PH [Rhizobium leguminosarum bv. viciae 384 1 1e-87
>gi|315121831|ref|YP_004062320.1| ribonuclease PH [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 250 Back     alignment and organism information
 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 202/239 (84%), Positives = 228/239 (95%)

Query: 1   MRLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWIT 60
           MRL GR+ENQMREIS TR +SK+AEGSCLVKFG+THLLTTATLEEKVP+W+RNTK+GWIT
Sbjct: 3   MRLLGRKENQMREISFTRGISKHAEGSCLVKFGETHLLTTATLEEKVPIWLRNTKNGWIT 62

Query: 61  AEYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQ 120
           AEYGMLPRSTG+R+KREAVSGRQGGR+QEIQR+IGR+LRS+VDLSALG RQIIIDCDVIQ
Sbjct: 63  AEYGMLPRSTGSRIKREAVSGRQGGRTQEIQRLIGRSLRSIVDLSALGPRQIIIDCDVIQ 122

Query: 121 ADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGYPIVDLDYG 180
           ADGGTRTAAITGAW+ALHDCLQHMED ++KFQLSQVLKGHVAAISCG+L G PIVDL+Y 
Sbjct: 123 ADGGTRTAAITGAWIALHDCLQHMEDRNSKFQLSQVLKGHVAAISCGILSGNPIVDLNYE 182

Query: 181 EDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDVIS 239
           EDS+ID DANFVMTD+G+IVE+Q SAE+ATFSQD FF+MLNLAKDRI+DLI+LQKDVIS
Sbjct: 183 EDSSIDADANFVMTDAGNIVEIQVSAEKATFSQDQFFSMLNLAKDRISDLIRLQKDVIS 241


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159184261|ref|NP_353359.2| ribonuclease PH [Agrobacterium tumefaciens str. C58] Length = 238 Back     alignment and organism information
>gi|222084657|ref|YP_002543186.1| ribonuclease PH [Agrobacterium radiobacter K84] Length = 238 Back     alignment and organism information
>gi|15964129|ref|NP_384482.1| ribonuclease PH [Sinorhizobium meliloti 1021] Length = 239 Back     alignment and organism information
>gi|222147322|ref|YP_002548279.1| ribonuclease PH [Agrobacterium vitis S4] Length = 239 Back     alignment and organism information
>gi|325291761|ref|YP_004277625.1| ribonuclease PH [Agrobacterium sp. H13-3] Length = 238 Back     alignment and organism information
>gi|209547618|ref|YP_002279535.1| ribonuclease PH [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 239 Back     alignment and organism information
>gi|227820597|ref|YP_002824567.1| ribonuclease PH [Sinorhizobium fredii NGR234] Length = 239 Back     alignment and organism information
>gi|150395238|ref|YP_001325705.1| ribonuclease PH [Sinorhizobium medicae WSM419] Length = 239 Back     alignment and organism information
>gi|116250149|ref|YP_765987.1| ribonuclease PH [Rhizobium leguminosarum bv. viciae 3841] Length = 239 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target242 ribonuclease PH [Candidatus Liberibacter asiaticus str.
PRK00173238 PRK00173, rph, ribonuclease PH; Reviewed 1e-111
TIGR01966236 TIGR01966, RNasePH, ribonuclease PH 3e-95
PRK03983244 PRK03983, PRK03983, exosome complex exonuclease Rrp41; 3e-21
TIGR02065230 TIGR02065, ECX1, archaeal exosome-like complex exonucle 7e-19
KOG1068245 KOG1068, KOG1068, KOG1068, Exosomal 3'-5' exoribonuclea 2e-17
COG2123272 COG2123, COG2123, RNase PH-related exoribonuclease [Tra 1e-12
PRK04282271 PRK04282, PRK04282, exosome complex RNA-binding protein 6e-12
KOG1067 760 KOG1067, KOG1067, KOG1067, Predicted RNA-binding polyri 3e-05
KOG1614291 KOG1614, KOG1614, KOG1614, Exosomal 3'-5' exoribonuclea 5e-05
COG1185 692 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase 0.002
COG0689230 COG0689, Rph, RNase PH [Translation, ribosomal structur 2e-66
pfam01138128 pfam01138, RNase_PH, 3' exoribonuclease family, domain 3e-28
TIGR03591 684 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyl 7e-04
pfam0372567 pfam03725, RNase_PH_C, 3' exoribonuclease family, domai 2e-08
KOG1067 760 KOG1067, KOG1067, KOG1067, Predicted RNA-binding polyri 7e-05
>gnl|CDD|178914 PRK00173, rph, ribonuclease PH; Reviewed Back     alignment and domain information
>gnl|CDD|131021 TIGR01966, RNasePH, ribonuclease PH Back     alignment and domain information
>gnl|CDD|179695 PRK03983, PRK03983, exosome complex exonuclease Rrp41; Provisional Back     alignment and domain information
>gnl|CDD|131120 TIGR02065, ECX1, archaeal exosome-like complex exonuclease 1 Back     alignment and domain information
>gnl|CDD|36286 KOG1068, KOG1068, KOG1068, Exosomal 3'-5' exoribonuclease complex, subunit Rrp41 and related exoribonucleases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|32306 COG2123, COG2123, RNase PH-related exoribonuclease [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179808 PRK04282, PRK04282, exosome complex RNA-binding protein Rrp42; Provisional Back     alignment and domain information
>gnl|CDD|36285 KOG1067, KOG1067, KOG1067, Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|36827 KOG1614, KOG1614, KOG1614, Exosomal 3'-5' exoribonuclease complex, subunit Rrp45 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31378 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31033 COG0689, Rph, RNase PH [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|144653 pfam01138, RNase_PH, 3' exoribonuclease family, domain 1 Back     alignment and domain information
>gnl|CDD|163340 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>gnl|CDD|146389 pfam03725, RNase_PH_C, 3' exoribonuclease family, domain 2 Back     alignment and domain information
>gnl|CDD|36285 KOG1067, KOG1067, KOG1067, Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 242 ribonuclease PH [Candidatus Liberibacter asiaticus str.
PRK00173237 rph ribonuclease PH; Reviewed 100.0
TIGR02065231 ECX1 exosome complex exonuclease 1; InterPro: IPR011807 100.0
TIGR01966237 RNasePH ribonuclease PH; InterPro: IPR002381 Prokaryoti 100.0
PRK03983243 exosome complex exonuclease Rrp41; Provisional 100.0
PRK04282271 exosome complex RNA-binding protein Rrp42; Provisional 100.0
COG0689230 Rph RNase PH [Translation, ribosomal structure and biog 100.0
COG2123272 RNase PH-related exoribonuclease [Translation, ribosoma 100.0
KOG1068245 consensus 100.0
KOG1614291 consensus 100.0
PRK11824 694 polynucleotide phosphorylase/polyadenylase; Provisional 100.0
TIGR03591 684 polynuc_phos polyribonucleotide nucleotidyltransferase. 100.0
KOG1069217 consensus 99.98
KOG1612288 consensus 99.97
KOG1613298 consensus 99.97
TIGR03591 684 polynuc_phos polyribonucleotide nucleotidyltransferase. 99.97
PRK11824 694 polynucleotide phosphorylase/polyadenylase; Provisional 99.97
KOG1067 760 consensus 99.94
COG1185 692 Pnp Polyribonucleotide nucleotidyltransferase (polynucl 99.93
COG1185 692 Pnp Polyribonucleotide nucleotidyltransferase (polynucl 99.9
KOG1067 760 consensus 99.75
TIGR02696 725 pppGpp_PNP guanosine pentaphosphate synthetase I/polyri 99.66
TIGR02696 725 pppGpp_PNP guanosine pentaphosphate synthetase I/polyri 98.91
pfam01138128 RNase_PH 3' exoribonuclease family, domain 1. This fami 99.95
pfam0372567 RNase_PH_C 3' exoribonuclease family, domain 2. This fa 98.78
>PRK00173 rph ribonuclease PH; Reviewed Back     alignment and domain information
>TIGR02065 ECX1 exosome complex exonuclease 1; InterPro: IPR011807 The PH (phosphorolytic) domain is responsible for 3'-5' exoribonuclease activity, although in some proteins this domain has lost its catalytic function Back     alignment and domain information
>TIGR01966 RNasePH ribonuclease PH; InterPro: IPR002381 Prokaryotic ribonuclease PH (2 Back     alignment and domain information
>PRK03983 exosome complex exonuclease Rrp41; Provisional Back     alignment and domain information
>PRK04282 exosome complex RNA-binding protein Rrp42; Provisional Back     alignment and domain information
>COG0689 Rph RNase PH [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2123 RNase PH-related exoribonuclease [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1068 consensus Back     alignment and domain information
>KOG1614 consensus Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG1069 consensus Back     alignment and domain information
>KOG1612 consensus Back     alignment and domain information
>KOG1613 consensus Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>KOG1067 consensus Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1067 consensus Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase; InterPro: IPR014069 The of the characterization of two proteins from Streptomyces coelicolor ahs been presented Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase; InterPro: IPR014069 The of the characterization of two proteins from Streptomyces coelicolor ahs been presented Back     alignment and domain information
>pfam01138 RNase_PH 3' exoribonuclease family, domain 1 Back     alignment and domain information
>pfam03725 RNase_PH_C 3' exoribonuclease family, domain 2 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target242 ribonuclease PH [Candidatus Liberibacter asiaticus str.
1r6m_A239 Crystal Structure Of The Trna Processing Enzyme Rna 3e-46
1oyp_A245 Crystal Structure Of The Phosphorolytic Exoribonucl 3e-44
1r6l_A239 Crystal Structure Of The Trna Processing Enzyme Rna 5e-44
1oys_A245 Crystal Structure Of The Phosphorolytic Exoribonucl 3e-43
3dd6_A255 Crystal Structure Of Rph, An Exoribonuclease From B 4e-42
1udo_A255 Crystal Structure Of The Trna Processing Enzyme Rna 2e-40
1udn_A255 Crystal Structure Of The Trna Processing Enzyme Rna 2e-40
1udq_A255 Crystal Structure Of The Trna Processing Enzyme Rna 3e-40
1uds_A255 Crystal Structure Of The Trna Processing Enzyme Rna 3e-40
3b4t_A262 Crystal Structure Of Mycobacterium Tuberculosis Rna 9e-38
3cdj_A559 Crystal Structure Of The E. Coli KhS1 DOMAIN TRUNCA 1e-33
3cdj_A 559 Crystal Structure Of The E. Coli KhS1 DOMAIN TRUNCA 5e-18
3h1c_A549 Crystal Structure Of Polynucleotide Phosphorylase ( 1e-33
3h1c_A 549 Crystal Structure Of Polynucleotide Phosphorylase ( 6e-18
3gcm_A549 Crystal Structure Of E. Coli Polynucleotide Phospho 1e-33
3gcm_A 549 Crystal Structure Of E. Coli Polynucleotide Phospho 2e-18
3cdi_A 723 Crystal Structure Of E. Coli Pnpase Length = 723 3e-33
3cdi_A 723 Crystal Structure Of E. Coli Pnpase Length = 723 1e-17
2pnz_A249 Crystal Structure Of The P. Abyssi Exosome Rnase Ph 1e-29
1e3p_A 757 Tungstate Derivative Of Streptomyces Antibioticus P 2e-29
1e3p_A 757 Tungstate Derivative Of Streptomyces Antibioticus P 1e-12
3l7z_B245 Crystal Structure Of The S. Solfataricus Archaeal E 4e-29
2ba0_F258 Archaeal Exosome Core Length = 258 7e-29
2br2_B248 Rnase Ph Core Of The Archaeal Exosome Length = 248 8e-29
3m7n_D258 Archaeoglobus Fulgidus Exosome With Rna Bound To Th 1e-28
2je6_B250 Structure Of A 9-Subunit Archaeal Exosome Length = 2e-28
2wnr_B240 The Structure Of Methanothermobacter Thermautotroph 3e-28
1e3h_A 757 Semet Derivative Of Streptomyces Antibioticus Pnpas 5e-27
1e3h_A 757 Semet Derivative Of Streptomyces Antibioticus Pnpas 3e-11
2je6_A277 Structure Of A 9-Subunit Archaeal Exosome Length = 2e-23
2br2_A275 Rnase Ph Core Of The Archaeal Exosome Length = 275 2e-23
3l7z_A271 Crystal Structure Of The S. Solfataricus Archaeal E 2e-23
2wnr_A271 The Structure Of Methanothermobacter Thermautotroph 2e-22
2ba0_I259 Archaeal Exosome Core Length = 259 7e-22
2nn6_B249 Structure Of The Human Rna Exosome Composed Of Rrp4 8e-22
3m85_G259 Archaeoglobus Fulgidus Exosome Y70a With Rna Bound 1e-21
2pnz_B277 Crystal Structure Of The P. Abyssi Exosome Rnase Ph 6e-21
2nn6_C278 Structure Of The Human Rna Exosome Composed Of Rrp4 1e-19
3hkm_A246 Crystal Structure Of Rice(Oryza Sativa) Rrp46 Lengt 3e-16
2nn6_E305 Structure Of The Human Rna Exosome Composed Of Rrp4 4e-14
2wp8_B246 Yeast Rrp44 Nuclease Length = 246 4e-13
2nn6_A358 Structure Of The Human Rna Exosome Composed Of Rrp4 2e-12
3krn_A222 Crystal Structure Of C. Elegans Cell-Death-Related 1e-07
2wp8_A305 Yeast Rrp44 Nuclease Length = 305 1e-06
2nn6_F272 Structure Of The Human Rna Exosome Composed Of Rrp4 2e-06
2nn6_D237 Structure Of The Human Rna Exosome Composed Of Rrp4 7e-06
gi|46015434|pdb|1R6M|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph From Pseudomonas Aeruginosa In Complex With Phosphate Length = 239 Back     alignment and structure
 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 124/239 (51%), Positives = 163/239 (68%), Gaps = 2/239 (0%)

Query: 2   RLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWITA 61
           R SGR  +Q+R I +TR  +K+AEGS LV+FGDT ++ T + E  VP +++    GW+TA
Sbjct: 3   RPSGRAADQLRPIRITRHYTKHAEGSVLVEFGDTKVICTVSAESGVPRFLKGQGQGWLTA 62

Query: 62  EYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQA 121
           EYGMLPRSTG R +REA  G+QGGR+ EIQR+IGR+LR+ +DLS LG   + IDCDVIQA
Sbjct: 63  EYGMLPRSTGERNQREASRGKQGGRTLEIQRLIGRSLRAALDLSKLGENTLYIDCDVIQA 122

Query: 122 DGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGYPIVDLDYGE 181
           DGGTRTA+ITGA VAL D L  ++           LK  VAA+S G+  G P++DLDY E
Sbjct: 123 DGGTRTASITGATVALIDALAVLKKR--GALKGNPLKQMVAAVSVGIYQGVPVLDLDYLE 180

Query: 182 DSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDVISN 240
           DS  + D N VMTD+G  +EVQG+AE A F      AML LA+  + +L +LQ+  ++ 
Sbjct: 181 DSAAETDLNVVMTDAGGFIEVQGTAEGAPFRPAELNAMLELAQQGMQELFELQRAALAE 239


gi|47168514|pdb|1OYP|A Chain A, Crystal Structure Of The Phosphorolytic Exoribonuclease Rnase Ph From Bacillus Subtilis Length = 245 Back     alignment and structure
>gi|46015433|pdb|1R6L|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph From Pseudomonas Aeruginosa Length = 239 Back     alignment and structure
>gi|47168526|pdb|1OYS|A Chain A, Crystal Structure Of The Phosphorolytic Exoribonuclease Rnase Ph From Bacillus Subtilis Length = 245 Back     alignment and structure
>gi|223365844|pdb|3DD6|A Chain A, Crystal Structure Of Rph, An Exoribonuclease From Bacillus Anthracis At 1.7 A Resolution Length = 255 Back     alignment and structure
>gi|37928168|pdb|1UDO|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph R86a Mutant From Aquifex Aeolicus Length = 255 Back     alignment and structure
gi|37928163|pdb|1UDN|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph From Aquifex Aeolicus Length = 255 Back     alignment and structure
>gi|37928170|pdb|1UDQ|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph T125a Mutant From Aquifex Aeolicus Length = 255 Back     alignment and structure
>gi|37928172|pdb|1UDS|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph R126a Mutant From Aquifex Aeolicus Length = 255 Back     alignment and structure
>gi|160877892|pdb|3B4T|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Rnase Ph, The Mycobacterium Tuberculosis Structural Genomics Consortium Target Rv1340 Length = 262 Back     alignment and structure
>gi|217035383|pdb|3CDJ|A Chain A, Crystal Structure Of The E. Coli KhS1 DOMAIN TRUNCATED Pnpase Length = 559 Back     alignment and structure
>gi|217035383|pdb|3CDJ|A Chain A, Crystal Structure Of The E. Coli KhS1 DOMAIN TRUNCATED Pnpase Length = 559 Back     alignment and structure
>gi|237823993|pdb|3H1C|A Chain A, Crystal Structure Of Polynucleotide Phosphorylase (Pnpase) Core Bound To Rnase E And Tungstate Length = 549 Back     alignment and structure
>gi|237823993|pdb|3H1C|A Chain A, Crystal Structure Of Polynucleotide Phosphorylase (Pnpase) Core Bound To Rnase E And Tungstate Length = 549 Back     alignment and structure
>gi|239781891|pdb|3GCM|A Chain A, Crystal Structure Of E. Coli Polynucleotide Phosphorylase Bound To Rna And Rnase E Length = 549 Back     alignment and structure
>gi|239781891|pdb|3GCM|A Chain A, Crystal Structure Of E. Coli Polynucleotide Phosphorylase Bound To Rna And Rnase E Length = 549 Back     alignment and structure
>gi|217035382|pdb|3CDI|A Chain A, Crystal Structure Of E. Coli Pnpase Length = 723 Back     alignment and structure
>gi|217035382|pdb|3CDI|A Chain A, Crystal Structure Of E. Coli Pnpase Length = 723 Back     alignment and structure
gi|170292234|pdb|2PNZ|A Chain A, Crystal Structure Of The P. Abyssi Exosome Rnase Ph Ring Complexed With Udp And Gmp Length = 249 Back     alignment and structure
>gi|11514054|pdb|1E3P|A Chain A, Tungstate Derivative Of Streptomyces Antibioticus Pnpase Gpsi Enzyme Length = 757 Back     alignment and structure
>gi|11514054|pdb|1E3P|A Chain A, Tungstate Derivative Of Streptomyces Antibioticus Pnpase Gpsi Enzyme Length = 757 Back     alignment and structure
gi|299689089|pdb|3L7Z|B Chain B, Crystal Structure Of The S. Solfataricus Archaeal Exosome Length = 245 Back     alignment and structure
gi|83754325|pdb|2BA0|F Chain F, Archaeal Exosome Core Length = 258 Back     alignment and structure
gi|71042717|pdb|2BR2|B Chain B, Rnase Ph Core Of The Archaeal Exosome Length = 248 Back     alignment and structure
>gi|295322007|pdb|3M7N|D Chain D, Archaeoglobus Fulgidus Exosome With Rna Bound To The Active Site Length = 258 Back     alignment and structure
>gi|126031138|pdb|2JE6|B Chain B, Structure Of A 9-Subunit Archaeal Exosome Length = 250 Back     alignment and structure
gi|295321490|pdb|2WNR|B Chain B, The Structure Of Methanothermobacter Thermautotrophicus Exosome Core Assembly Length = 240 Back     alignment and structure
>gi|11514023|pdb|1E3H|A Chain A, Semet Derivative Of Streptomyces Antibioticus PnpaseGPSI Enzyme Length = 757 Back     alignment and structure
>gi|11514023|pdb|1E3H|A Chain A, Semet Derivative Of Streptomyces Antibioticus PnpaseGPSI Enzyme Length = 757 Back     alignment and structure
>gi|126031137|pdb|2JE6|A Chain A, Structure Of A 9-Subunit Archaeal Exosome Length = 277 Back     alignment and structure
gi|71042716|pdb|2BR2|A Chain A, Rnase Ph Core Of The Archaeal Exosome Length = 275 Back     alignment and structure
>gi|299689088|pdb|3L7Z|A Chain A, Crystal Structure Of The S. Solfataricus Archaeal Exosome Length = 271 Back     alignment and structure
gi|295321489|pdb|2WNR|A Chain A, The Structure Of Methanothermobacter Thermautotrophicus Exosome Core Assembly Length = 271 Back     alignment and structure
gi|83754328|pdb|2BA0|I Chain I, Archaeal Exosome Core Length = 259 Back     alignment and structure
>gi|122920908|pdb|2NN6|B Chain B, Structure Of The Human Rna Exosome Composed Of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40 Length = 249 Back     alignment and structure
>gi|295322022|pdb|3M85|G Chain G, Archaeoglobus Fulgidus Exosome Y70a With Rna Bound To The Active Site Length = 259 Back     alignment and structure
>gi|170292235|pdb|2PNZ|B Chain B, Crystal Structure Of The P. Abyssi Exosome Rnase Ph Ring Complexed With Udp And Gmp Length = 277 Back     alignment and structure
>gi|122920909|pdb|2NN6|C Chain C, Structure Of The Human Rna Exosome Composed Of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40 Length = 278 Back     alignment and structure
>gi|284793943|pdb|3HKM|A Chain A, Crystal Structure Of Rice(Oryza Sativa) Rrp46 Length = 246 Back     alignment and structure
>gi|122920911|pdb|2NN6|E Chain E, Structure Of The Human Rna Exosome Composed Of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40 Length = 305 Back     alignment and structure
>gi|266618485|pdb|2WP8|B Chain B, Yeast Rrp44 Nuclease Length = 246 Back     alignment and structure
>gi|122920907|pdb|2NN6|A Chain A, Structure Of The Human Rna Exosome Composed Of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40 Length = 358 Back     alignment and structure
>gi|284794093|pdb|3KRN|A Chain A, Crystal Structure Of C. Elegans Cell-Death-Related Nuclease 5(Crn-5) Length = 222 Back     alignment and structure
gi|266618484|pdb|2WP8|A Chain A, Yeast Rrp44 Nuclease Length = 305 Back     alignment and structure
gi|122920912|pdb|2NN6|F Chain F, Structure Of The Human Rna Exosome Composed Of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40 Length = 272 Back     alignment and structure
>gi|122920910|pdb|2NN6|D Chain D, Structure Of The Human Rna Exosome Composed Of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40 Length = 237 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target242 ribonuclease PH [Candidatus Liberibacter asiaticus str.
1e3p_A 757 Guanosine pentaphosphate synthetase; polyribonucleotide 8e-53
1e3p_A 757 Guanosine pentaphosphate synthetase; polyribonucleotide 3e-27
3dd6_A255 Ribonuclease PH; exoribonuclease, tRNA maturation, RNAs 1e-50
3gme_A549 Polyribonucleotide nucleotidyltransferase; protein-RNA 1e-48
3gme_A 549 Polyribonucleotide nucleotidyltransferase; protein-RNA 8e-06
1oys_A245 Ribonuclease PH; transferase, tRNA processing; 2.40A {B 1e-48
1r6l_A239 Ribonuclease PH; beta-alpha-beta-alpha fold, hexamer, p 1e-48
2nn6_A358 Polymyositis/scleroderma autoantigen 1; RNA, exosome, P 7e-48
3m7n_D258 Probable exosome complex exonuclease 1; exosome, RNA, e 4e-44
2wnr_B240 Probable exosome complex exonuclease 1; phosphate bindi 7e-44
2wnr_A271 Probable exosome complex exonuclease 2; phosphate bindi 1e-39
1udn_A255 Ribonuclease PH, RNAse PH; transferase, riken structura 4e-39
3m7n_G259 Probable exosome complex exonuclease 2; exosome, RNA, e 1e-38
3hkm_A246 OS03G0854200 protein; RNAse PH domain, phosphorylase; 1 2e-38
3krn_A222 Protein C14A4.5, confirmed by transcript evidence; RNAs 9e-38
3b4t_A262 Ribonuclease PH; RNAse, tRNA nucleotidyltransferase, RP 3e-37
2wp8_A305 Exosome complex component RRP45; nucleus, hydrolase, cy 4e-36
2nn6_E305 Exosome complex exonuclease RRP42; RNA, exosome, PM/SCL 1e-33
2po1_B277 Probable exosome complex exonuclease 2; RNAse PH, hydro 4e-33
2nn6_C278 Exosome complex exonuclease RRP43; RNA, exosome, PM/SCL 5e-33
2nn6_F272 MTR3, exosome component 6; RNA, exosome, PM/SCL, phosph 2e-29
2ba0_I259 Archeal exosome RNA binding protein RRP42; RNAse PH, RN 6e-29
2je6_A277 RRP42, exosome complex exonuclease 2; nuclease, hydrola 3e-28
2ba0_F258 Archeal exosome RNA binding protein RRP41; RNAse PH, RN 6e-28
2po1_A249 Probable exosome complex exonuclease 1; RNAse PH, hydro 7e-28
2wp8_B246 Exosome complex component SKI6; nucleus, hydrolase, cyt 1e-25
2je6_B250 RRP41, exosome complex exonuclease 1; nuclease, hydrola 1e-23
3cdi_A 723 Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA 1e-23
3cdi_A 723 Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA 6e-06
2nn6_B249 Exosome complex exonuclease RRP41; RNA, exosome, PM/SCL 2e-23
2nn6_D237 Exosome complex exonuclease RRP46; RNA, exosome, PM/SCL 3e-22
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 Back     alignment and structure
 Score =  201 bits (514), Expect = 8e-53
 Identities = 43/250 (17%), Positives = 82/250 (32%), Gaps = 30/250 (12%)

Query: 2   RLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATL----EEKVPMWIRNTKHG 57
           R+ GR    +R ++          GS L + G+T +L   TL     E+    +      
Sbjct: 356 RIDGRGVTDIRTLAAEVEAIPRVHGSALFERGETQILGVTTLNMLRMEQQLDTLSPVTRK 415

Query: 58  WITAEYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCD 117
                Y   P S G   +     G    R      +  RA+  V+         I    +
Sbjct: 416 RYMHNYNFPPYSVGETGRV----GSPKRREIGHGALAERAIVPVLPTREEFPYAIRQVSE 471

Query: 118 VIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGHVAAISCGMLCGY----- 172
            + ++G T   ++  + ++L +    +             K  VA I+ G++        
Sbjct: 472 ALGSNGSTSMGSVCASTMSLLNAGVPL-------------KAPVAGIAMGLISQEINGET 518

Query: 173 ---PIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIAD 229
               + D+   ED+  D+D     T    +  +Q   +          A L  A+D    
Sbjct: 519 HYVALTDILGAEDAFGDMDFKVAGTKEF-VTALQLDTKLDGIPASVLAAALKQARDARLH 577

Query: 230 LIKLQKDVIS 239
           ++ +  + I 
Sbjct: 578 ILDVMMEAID 587


>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 Back     alignment and structure
>3dd6_A Ribonuclease PH; exoribonuclease, tRNA maturation, RNAse PH., transferase; 1.70A {Bacillus anthracis} Length = 255 Back     alignment and structure
>3gme_A Polyribonucleotide nucleotidyltransferase; protein-RNA complex, cytoplasm, nucleotidyltransferase, RNA- binding, transferase, hydrolase; 2.40A {Escherichia coli E24377A} PDB: 3gll_A 3gcm_A 3h1c_A 3cdj_A Length = 549 Back     alignment and structure
>3gme_A Polyribonucleotide nucleotidyltransferase; protein-RNA complex, cytoplasm, nucleotidyltransferase, RNA- binding, transferase, hydrolase; 2.40A {Escherichia coli E24377A} PDB: 3gll_A 3gcm_A 3h1c_A 3cdj_A Length = 549 Back     alignment and structure
>1oys_A Ribonuclease PH; transferase, tRNA processing; 2.40A {Bacillus subtilis} SCOP: d.14.1.4 d.101.1.1 PDB: 1oyp_A 1oyr_A Length = 245 Back     alignment and structure
>1r6l_A Ribonuclease PH; beta-alpha-beta-alpha fold, hexamer, phosphate bound, transferase; HET: NHE; 1.90A {Pseudomonas aeruginosa} SCOP: d.14.1.4 d.101.1.1 PDB: 1r6m_A Length = 239 Back     alignment and structure
>2nn6_A Polymyositis/scleroderma autoantigen 1; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 358 Back     alignment and structure
>3m7n_D Probable exosome complex exonuclease 1; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 3m85_D 2ba0_F 2ba1_E Length = 258 Back     alignment and structure
>2wnr_B Probable exosome complex exonuclease 1; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacterthermautotrophicus} Length = 240 Back     alignment and structure
>2wnr_A Probable exosome complex exonuclease 2; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacterthermautotrophicus} Length = 271 Back     alignment and structure
>1udn_A Ribonuclease PH, RNAse PH; transferase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Aquifex aeolicus} SCOP: d.14.1.4 d.101.1.1 PDB: 1udq_A 1uds_A 1udo_A Length = 255 Back     alignment and structure
>3m7n_G Probable exosome complex exonuclease 2; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_H 2ba0_I 3m85_G Length = 259 Back     alignment and structure
>3hkm_A OS03G0854200 protein; RNAse PH domain, phosphorylase; 1.98A {Oryza sativa japonica group} Length = 246 Back     alignment and structure
>3krn_A Protein C14A4.5, confirmed by transcript evidence; RNAse PH domain, homodimer, exosome, cell-death-related DNAse; 3.92A {Caenorhabditis elegans} Length = 222 Back     alignment and structure
>3b4t_A Ribonuclease PH; RNAse, tRNA nucleotidyltransferase, RPHA, structural genomics, TBSGC; 2.10A {Mycobacterium tuberculosis H37RV} Length = 262 Back     alignment and structure
>2wp8_A Exosome complex component RRP45; nucleus, hydrolase, cytoplasm, RNA-binding, RNA binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Length = 305 Back     alignment and structure
>2nn6_E Exosome complex exonuclease RRP42; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 305 Back     alignment and structure
>2po1_B Probable exosome complex exonuclease 2; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_B* 2pnz_B 2po2_B* Length = 277 Back     alignment and structure
>2nn6_C Exosome complex exonuclease RRP43; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 278 Back     alignment and structure
>2nn6_F MTR3, exosome component 6; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 272 Back     alignment and structure
>2ba0_I Archeal exosome RNA binding protein RRP42; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: d.14.1.4 d.101.1.1 PDB: 2ba1_H Length = 259 Back     alignment and structure
>2je6_A RRP42, exosome complex exonuclease 2; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_A* 2jeb_A* 2br2_A 2c37_A* 2c38_A* 2c39_A* Length = 277 Back     alignment and structure
>2ba0_F Archeal exosome RNA binding protein RRP41; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: d.14.1.4 d.101.1.1 PDB: 2ba1_E Length = 258 Back     alignment and structure
>2po1_A Probable exosome complex exonuclease 1; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_A* 2pnz_A 2po2_A* Length = 249 Back     alignment and structure
>2wp8_B Exosome complex component SKI6; nucleus, hydrolase, cytoplasm, RNA-binding, RNA binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>2je6_B RRP41, exosome complex exonuclease 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_B* 2jeb_B* 2br2_B 2c37_B* 2c38_B* 2c39_B* Length = 250 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 Back     alignment and structure
>2nn6_B Exosome complex exonuclease RRP41; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 249 Back     alignment and structure
>2nn6_D Exosome complex exonuclease RRP46; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 237 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target242 ribonuclease PH [Candidatus Liberibacter asiaticus str.
3dd6_A255 Ribonuclease PH; exoribonuclease, tRNA maturation, RNAs 100.0
3b4t_A262 Ribonuclease PH; RNAse, tRNA nucleotidyltransferase, RP 100.0
1udn_A255 Ribonuclease PH, RNAse PH; transferase, riken structura 100.0
1oys_A245 Ribonuclease PH; transferase, tRNA processing; 2.40A {B 100.0
2po1_A249 Probable exosome complex exonuclease 1; RNAse PH, hydro 100.0
2wnr_B240 Probable exosome complex exonuclease 1; phosphate bindi 100.0
3m7n_D258 Probable exosome complex exonuclease 1; exosome, RNA, e 100.0
2je6_B250 RRP41, exosome complex exonuclease 1; nuclease, hydrola 100.0
2wp8_B246 Exosome complex component SKI6; nucleus, hydrolase, cyt 100.0
1r6l_A239 Ribonuclease PH; beta-alpha-beta-alpha fold, hexamer, p 100.0
2nn6_B249 Exosome complex exonuclease RRP41; RNA, exosome, PM/SCL 100.0
2nn6_E305 Exosome complex exonuclease RRP42; RNA, exosome, PM/SCL 100.0
2nn6_C278 Exosome complex exonuclease RRP43; RNA, exosome, PM/SCL 100.0
3m7n_G259 Probable exosome complex exonuclease 2; exosome, RNA, e 100.0
2po1_B277 Probable exosome complex exonuclease 2; RNAse PH, hydro 100.0
2nn6_A358 Polymyositis/scleroderma autoantigen 1; RNA, exosome, P 100.0
2je6_A277 RRP42, exosome complex exonuclease 2; nuclease, hydrola 100.0
2wnr_A271 Probable exosome complex exonuclease 2; phosphate bindi 100.0
3hkm_A246 OS03G0854200 protein; RNAse PH domain, phosphorylase; 1 100.0
2nn6_F272 MTR3, exosome component 6; RNA, exosome, PM/SCL, phosph 100.0
2wp8_A305 Exosome complex component RRP45; nucleus, hydrolase, cy 100.0
3gme_A549 Polyribonucleotide nucleotidyltransferase; protein-RNA 100.0
2nn6_D237 Exosome complex exonuclease RRP46; RNA, exosome, PM/SCL 100.0
3krn_A222 Protein C14A4.5, confirmed by transcript evidence; RNAs 100.0
3cdi_A 723 Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA 100.0
1e3p_A 757 Guanosine pentaphosphate synthetase; polyribonucleotide 100.0
3cdi_A 723 Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA 99.97
3gme_A 549 Polyribonucleotide nucleotidyltransferase; protein-RNA 99.97
1e3p_A 757 Guanosine pentaphosphate synthetase; polyribonucleotide 99.95
>3dd6_A Ribonuclease PH; exoribonuclease, tRNA maturation, RNAse PH., transferase; 1.70A {Bacillus anthracis} Back     alignment and structure
Probab=100.00  E-value=0  Score=316.20  Aligned_cols=240  Identities=47%  Similarity=0.755  Sum_probs=222.8

Q ss_pred             CCCCCCCCCCEEEEEEEECCCCCCCCEEEEEECCCEEEEEEEECCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             96789980117879999766326882899996894899999933324531015543421100100555653222333444
Q gi|254780630|r    1 MRLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWITAEYGMLPRSTGNRVKREAVS   80 (242)
Q Consensus         1 iR~DGR~~~e~R~i~i~~g~~~~a~GSa~v~~G~T~Vl~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~   80 (242)
                      ||+|||+++|+|+|++++|++++|||||+|++|+|+|+|+|++|.+.|+..+.+..+.+.+.+.+.|++...+.......
T Consensus        11 iR~DGR~~~e~R~i~~~~g~l~~a~GSa~v~~G~T~Vl~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   90 (255)
T 3dd6_A           11 MRVDGREKTELRHIHIHTNYLKHPEGSVLIEVGDTKVICSATIEERVPPFMRGEGKGWVTAEYAMIPRATEQRTIRESSK   90 (255)
T ss_dssp             CCCCSCCTTCCCCEEEEESCSSSSSEEEEEEETTEEEEEEEEEESCCCGGGTTSSCCEEEEEEEECTTSSSSCCCCCCC-
T ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCEEEEEEECCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCC
T ss_conf             32899698885576999697899987999998992999999826547741146555616899983254445543334578


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEECCCCCCCCHHHHCCCCCCCHHHCCCCCCCCCCCCEECCCCCC
Q ss_conf             47773102344443224210002200488022234420355576310100012221011001000001463101124378
Q gi|254780630|r   81 GRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQADGGTRTAAITGAWVALHDCLQHMEDCSNKFQLSQVLKGH  160 (242)
Q Consensus        81 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~i~i~v~v~~~dg~~~~a~~~a~~~Al~~a~i~~~~~~~~~~~~~~~~~~  160 (242)
                      ++..+++.+.++.+++++++.+..+.+++|++.++++++++||++++++++|+++||.++++|+.+.  ....++++..+
T Consensus        91 ~~~~~~~~~~~~~i~~~l~~~i~~~~~~~~~I~v~v~vl~~DG~~~da~~~aa~~AL~~~~~~~~~~--~~~~~i~~~~~  168 (255)
T 3dd6_A           91 GKVTGRTMEIQRLIGRALRAVVDLEALGERTVWIDCDVIQADGGTRTASITGAYVAMVLAFEKLLQA--EKVSKIPVKDY  168 (255)
T ss_dssp             CCCCHHHHHHHHHHHHHHHHHBCHHHHCSCEEEEEEEEEECSSCHHHHHHHHHHHHHHHHHHHHHHT--TSSSSCCBSSC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHC--CCCCCCCCCCC
T ss_conf             8987659999999987999753813367689999886134567712766666789999986899874--77555650134


Q ss_pred             CCEEECCCCCCC-CEECCCCCCCCCCCEEEEEEECCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             310200454554-1003343101234303688875998689999218636868999999999999999999999999977
Q gi|254780630|r  161 VAAISCGMLCGY-PIVDLDYGEDSTIDVDANFVMTDSGHIVEVQGSAERATFSQDHFFAMLNLAKDRIADLIKLQKDVIS  239 (242)
Q Consensus       161 ~~~~~~~~~~~~-~~~d~~~~ee~~~~~~l~v~~~~~~~i~~i~~~g~~~~~~~~~l~~~l~~a~~~~~~i~~~i~~~L~  239 (242)
                      +.++..+...+. ++.||+.+||..+++.++++++++|++|.+++.|++++|+++++.+|+++|+++|++|+++|+++|+
T Consensus       169 ~~~~~~~~~~~~~iivDpt~~Ee~~~~~~ltv~~~~~g~i~~i~~~g~~~~~~~~~l~~~i~~A~~~~~~l~~~~~~~l~  248 (255)
T 3dd6_A          169 LAATSVGIVEEQGVVLDLNYAEDSKADVDMNVIMTGKGQFVEVQGTGEEATFSRAQLNELLDAAEQGIFQLIDIQKEALG  248 (255)
T ss_dssp             EEEEEEEEETTTEEEESCCHHHHHTEEEEEEEEEETTSCEEEEEEEESSSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHG
T ss_pred             CCCEEEEECCCCEEEECCCHHHHHCCCCCEEEEEECCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             22203664036528768897787315762799993899789998314779859999999999999999999999999999


Q ss_pred             HCC
Q ss_conf             209
Q gi|254780630|r  240 NEV  242 (242)
Q Consensus       240 ~~~  242 (242)
                      +.+
T Consensus       249 ~~~  251 (255)
T 3dd6_A          249 DIV  251 (255)
T ss_dssp             GGG
T ss_pred             HHH
T ss_conf             999



>3b4t_A Ribonuclease PH; RNAse, tRNA nucleotidyltransferase, RPHA, structural genomics, TBSGC; 2.10A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1udn_A Ribonuclease PH, RNAse PH; transferase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Aquifex aeolicus} SCOP: d.14.1.4 d.101.1.1 PDB: 1udq_A 1uds_A 1udo_A Back     alignment and structure
>1oys_A Ribonuclease PH; transferase, tRNA processing; 2.40A {Bacillus subtilis} SCOP: d.14.1.4 d.101.1.1 PDB: 1oyp_A 1oyr_A Back     alignment and structure
>2po1_A Probable exosome complex exonuclease 1; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_A* 2pnz_A 2po2_A* Back     alignment and structure
>2wnr_B Probable exosome complex exonuclease 1; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacterthermautotrophicus} Back     alignment and structure
>3m7n_D Probable exosome complex exonuclease 1; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 3m85_D 2ba0_F 2ba1_E Back     alignment and structure
>2je6_B RRP41, exosome complex exonuclease 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_B* 2jeb_B* 2br2_B 2c37_B* 2c38_B* 2c39_B* 3l7z_B Back     alignment and structure
>2wp8_B Exosome complex component SKI6; nucleus, hydrolase, cytoplasm, RNA-binding, RNA binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1r6l_A Ribonuclease PH; beta-alpha-beta-alpha fold, hexamer, phosphate bound, transferase; HET: NHE; 1.90A {Pseudomonas aeruginosa} SCOP: d.14.1.4 d.101.1.1 PDB: 1r6m_A Back     alignment and structure
>2nn6_B Exosome complex exonuclease RRP41; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>2nn6_E Exosome complex exonuclease RRP42; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>2nn6_C Exosome complex exonuclease RRP43; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>3m7n_G Probable exosome complex exonuclease 2; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_H 2ba0_I 3m85_G Back     alignment and structure
>2po1_B Probable exosome complex exonuclease 2; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_B* 2pnz_B 2po2_B* Back     alignment and structure
>2nn6_A Polymyositis/scleroderma autoantigen 1; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>2je6_A RRP42, exosome complex exonuclease 2; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_A* 2jeb_A* 2br2_A 2c37_A* 2c38_A* 2c39_A* 3l7z_A Back     alignment and structure
>2wnr_A Probable exosome complex exonuclease 2; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacterthermautotrophicus} Back     alignment and structure
>3hkm_A OS03G0854200 protein; RNAse PH domain, phosphorylase; 1.98A {Oryza sativa japonica group} Back     alignment and structure
>2nn6_F MTR3, exosome component 6; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>2wp8_A Exosome complex component RRP45; nucleus, hydrolase, cytoplasm, RNA-binding, RNA binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3gme_A Polyribonucleotide nucleotidyltransferase; protein-RNA complex, cytoplasm, nucleotidyltransferase, RNA- binding, transferase, hydrolase; 2.40A {Escherichia coli E24377A} PDB: 3gll_A 3gcm_A 3h1c_A 3cdj_A Back     alignment and structure
>2nn6_D Exosome complex exonuclease RRP46; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Back     alignment and structure
>3krn_A Protein C14A4.5, confirmed by transcript evidence; RNAse PH domain, homodimer, exosome, cell-death-related DNAse; 3.92A {Caenorhabditis elegans} Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>3gme_A Polyribonucleotide nucleotidyltransferase; protein-RNA complex, cytoplasm, nucleotidyltransferase, RNA- binding, transferase, hydrolase; 2.40A {Escherichia coli E24377A} PDB: 3gll_A 3gcm_A 3h1c_A 3cdj_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 242 ribonuclease PH [Candidatus Liberibacter asiaticus str.
d1r6la1151 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomon 2e-26
d1oysa1151 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus 6e-26
d2je6b1148 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 4e-24
d2nn6e1187 d.14.1.4 (E:5-191) Exosome complex exonuclease RRP42 {H 6e-24
d2ba0g1176 d.14.1.4 (G:3-178) Exosome complex exonuclease 2,ECX2 { 8e-24
d1udsa1149 d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aquifex a 4e-23
d2nn6c1181 d.14.1.4 (C:7-187) Exosome complex exonuclease RRP43 {H 9e-23
d1e3ha3137 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guano 1e-22
d2ba0d1144 d.14.1.4 (D:10-153) Exosome complex exonuclease 1, ECX1 4e-21
d2nn6b1145 d.14.1.4 (B:6-150) Exosome complex exonuclease RRP41 {H 3e-20
d2nn6f1147 d.14.1.4 (F:29-175) Exosome complex exonuclease MTR3 {H 1e-19
d2nn6d1122 d.14.1.4 (D:25-146) Exosome complex exonuclease RRP46 { 2e-19
d2nn6a1184 d.14.1.4 (A:1-184) Exosome complex exonuclease RRP45 {H 2e-18
d2je6a1191 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 { 4e-18
d1e3ha2149 d.14.1.4 (A:3-151) Polynucleotide phosphorylase/guanosi 4e-14
d1udsa2105 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquife 3e-17
d2ba0g279 d.101.1.1 (G:179-257) Exosome complex exonuclease 2, EC 7e-17
d1r6la288 d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {Pseudo 5e-16
d2nn6c289 d.101.1.1 (C:188-276) Exosome complex exonuclease RRP43 5e-16
d1oysa286 d.101.1.1 (A:152-237) Ribonuclease PH, domain 2 {Bacill 2e-15
d2nn6d289 d.101.1.1 (D:147-235) Exosome complex exonuclease RRP46 2e-13
d2nn6a2118 d.101.1.1 (A:185-302) Exosome complex exonuclease RRP45 3e-13
d2je6a284 d.101.1.1 (A:192-275) Exosome complex exonuclease 2, EC 5e-13
d2nn6e294 d.101.1.1 (E:192-285) Exosome complex exonuclease RRP42 7e-13
d2je6b286 d.101.1.1 (B:156-241) Exosome complex exonuclease 1, EC 2e-12
d2ba0d299 d.101.1.1 (D:154-252) Exosome complex exonuclease 1, EC 6e-11
d2nn6b290 d.101.1.1 (B:151-240) Exosome complex exonuclease RRP41 3e-10
d2nn6f295 d.101.1.1 (F:176-270) Exosome complex exonuclease MTR3 5e-09
>d1r6la1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa [TaxId: 287]} Length = 151 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: Ribonuclease PH domain 1-like
domain: Ribonuclease PH, domain 1
species: Pseudomonas aeruginosa [TaxId: 287]
 Score =  113 bits (282), Expect = 2e-26
 Identities = 85/143 (59%), Positives = 108/143 (75%)

Query: 2   RLSGRQENQMREISLTRRVSKYAEGSCLVKFGDTHLLTTATLEEKVPMWIRNTKHGWITA 61
           R SGR  +Q+R I +TR  +K+AEGS LV+FGDT ++ T + E  VP +++    GW+TA
Sbjct: 3   RPSGRAADQLRPIRITRHYTKHAEGSVLVEFGDTKVICTVSAESGVPRFLKGQGQGWLTA 62

Query: 62  EYGMLPRSTGNRVKREAVSGRQGGRSQEIQRMIGRALRSVVDLSALGSRQIIIDCDVIQA 121
           EYGMLPRSTG R +REA  G+QGGR+ EIQR+IGR+LR+ +DLS LG   + IDCDVIQA
Sbjct: 63  EYGMLPRSTGERNQREASRGKQGGRTLEIQRLIGRSLRAALDLSKLGENTLYIDCDVIQA 122

Query: 122 DGGTRTAAITGAWVALHDCLQHM 144
           DGGTRTA+ITGA VAL D L  +
Sbjct: 123 DGGTRTASITGATVALIDALAVL 145


>d1oysa1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]} Length = 151 Back     information, alignment and structure
>d2je6b1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 148 Back     information, alignment and structure
>d2nn6e1 d.14.1.4 (E:5-191) Exosome complex exonuclease RRP42 {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d2ba0g1 d.14.1.4 (G:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 176 Back     information, alignment and structure
>d1udsa1 d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId: 63363]} Length = 149 Back     information, alignment and structure
>d2nn6c1 d.14.1.4 (C:7-187) Exosome complex exonuclease RRP43 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure
>d1e3ha3 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} Length = 137 Back     information, alignment and structure
>d2ba0d1 d.14.1.4 (D:10-153) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 144 Back     information, alignment and structure
>d2nn6b1 d.14.1.4 (B:6-150) Exosome complex exonuclease RRP41 {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d2nn6f1 d.14.1.4 (F:29-175) Exosome complex exonuclease MTR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d2nn6d1 d.14.1.4 (D:25-146) Exosome complex exonuclease RRP46 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d2nn6a1 d.14.1.4 (A:1-184) Exosome complex exonuclease RRP45 {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure
>d2je6a1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]} Length = 191 Back     information, alignment and structure
>d1e3ha2 d.14.1.4 (A:3-151) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} Length = 149 Back     information, alignment and structure
>d1udsa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId: 63363]} Length = 105 Back     information, alignment and structure
>d2ba0g2 d.101.1.1 (G:179-257) Exosome complex exonuclease 2, ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 79 Back     information, alignment and structure
>d1r6la2 d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {Pseudomonas aeruginosa [TaxId: 287]} Length = 88 Back&n